Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J8615_RS12475 Genome accession   NZ_CP072791
Coordinates   2556733..2556906 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GS-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2551733..2561906
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8615_RS12460 (J8615_12450) gcvT 2552551..2553651 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  J8615_RS12465 (J8615_12455) - 2554074..2555744 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  J8615_RS12470 (J8615_12460) - 2555762..2556556 (+) 795 WP_003153106.1 YqhG family protein -
  J8615_RS12475 (J8615_12465) sinI 2556733..2556906 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J8615_RS12480 (J8615_12470) sinR 2556940..2557275 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J8615_RS12485 (J8615_12475) tasA 2557323..2558108 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  J8615_RS12490 (J8615_12480) sipW 2558172..2558756 (-) 585 WP_046559873.1 signal peptidase I SipW -
  J8615_RS12495 (J8615_12485) tapA 2558728..2559399 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  J8615_RS12500 (J8615_12490) - 2559658..2559987 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J8615_RS12505 (J8615_12495) - 2560027..2560206 (-) 180 WP_003153093.1 YqzE family protein -
  J8615_RS12510 (J8615_12500) comGG 2560263..2560640 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  J8615_RS12515 (J8615_12505) comGF 2560641..2561036 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  J8615_RS12520 (J8615_12510) comGE 2561050..2561364 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J8615_RS12525 (J8615_12515) comGD 2561348..2561785 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=555836 J8615_RS12475 WP_003153105.1 2556733..2556906(+) (sinI) [Bacillus velezensis strain GS-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=555836 J8615_RS12475 WP_003153105.1 2556733..2556906(+) (sinI) [Bacillus velezensis strain GS-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702