Detailed information NTG0554031

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: J7D37_RS04315
• Genome accession: NZ_CP072526
• Coordinates: 910850..911176 (+)
• Length: 108 a.a.
• NCBI ID: WP_002126519.1
• Uniprot ID: -
• Organism: Acinetobacter baumannii strain DETAB-E227
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	906775..924061	910850..911176	within	0

Gene organization within MGE regions

Location: 906775..924061

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7D37_RS04285 (J7D37_04285)	-	906775..907281 (+)	507	WP_038347450.1	Bro-N domain-containing protein	-
J7D37_RS04290 (J7D37_04290)	-	907274..907642 (+)	369	WP_038347451.1	hypothetical protein	-
J7D37_RS04295 (J7D37_04295)	-	907652..907894 (+)	243	WP_038347452.1	hypothetical protein	-
J7D37_RS04300 (J7D37_04300)	-	907891..908202 (+)	312	WP_038347453.1	hypothetical protein	-
J7D37_RS04305 (J7D37_04305)	-	908195..908497 (+)	303	WP_038347454.1	hypothetical protein	-
J7D37_RS04310 (J7D37_04310)	-	908490..910610 (+)	2121	WP_038347455.1	DUF3987 domain-containing protein	-
J7D37_RS04315 (J7D37_04315)	ssb	910850..911176 (+)	327	WP_002126519.1	single-stranded DNA-binding protein	Machinery gene
J7D37_RS04320 (J7D37_04320)	-	913230..913661 (+)	432	WP_005124579.1	hypothetical protein	-
J7D37_RS04325 (J7D37_04325)	-	913914..914498 (+)	585	WP_038347456.1	hypothetical protein	-
J7D37_RS04330 (J7D37_04330)	-	914725..915672 (+)	948	WP_038347457.1	hypothetical protein	-
J7D37_RS04335 (J7D37_04335)	-	915929..916675 (+)	747	WP_038347598.1	KilA-N domain-containing protein	-
J7D37_RS04340 (J7D37_04340)	-	917099..918052 (+)	954	WP_038347458.1	hypothetical protein	-
J7D37_RS04345 (J7D37_04345)	-	918034..918351 (+)	318	WP_209303393.1	hypothetical protein	-
J7D37_RS04350 (J7D37_04350)	-	918402..918800 (+)	399	WP_140982881.1	three component ABC system middle component	-
J7D37_RS04355 (J7D37_04355)	-	918797..919495 (+)	699	WP_038347462.1	AAA family ATPase	-
J7D37_RS04360 (J7D37_04360)	-	919592..920650 (+)	1059	WP_209303394.1	DUF3732 domain-containing protein	-
J7D37_RS04365 (J7D37_04365)	-	920652..921650 (+)	999	WP_038347464.1	nucleoid-associated protein	-
J7D37_RS04370 (J7D37_04370)	-	921784..922068 (-)	285	WP_038347465.1	hypothetical protein	-
J7D37_RS04375 (J7D37_04375)	-	922715..924061 (-)	1347	WP_038347466.1	OprD family outer membrane porin	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12234.94 Da
• Isoelectric Point: 10.2394

>NTDB_id=554031 J7D37_RS04315 WP_002126519.1 910850..911176(+) (ssb) [Acinetobacter baumannii strain DETAB-E227]
MPNVNKVTVMGVLGRDPETKQFPNGGSVTTFSVATTEFWKDKTTGERKEATEWHRITTSNRLAEIASKYLKKGGKVYIEG
SLRTRKWKDSKGAEKEITEIRADEMQLL

Nucleotide

• Length: 327 bp

>NTDB_id=554031 J7D37_RS04315 WP_002126519.1 910850..911176(+) (ssb) [Acinetobacter baumannii strain DETAB-E227]
ATGCCAAACGTAAACAAAGTAACTGTGATGGGTGTACTAGGTCGTGACCCTGAAACTAAACAATTTCCCAACGGCGGAAG
CGTTACCACATTCAGCGTTGCAACTACTGAGTTTTGGAAAGACAAGACTACAGGCGAGCGTAAAGAAGCTACAGAGTGGC
ATAGAATCACCACCAGCAACCGTTTAGCCGAGATTGCCAGTAAGTACCTCAAGAAAGGCGGAAAGGTGTATATCGAAGGC
TCATTGCGTACAAGGAAGTGGAAGGACAGCAAAGGGGCGGAAAAGGAAATAACCGAGATTCGAGCAGATGAGATGCAATT
GCTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	55.556	100	0.556
ssb	Neisseria gonorrhoeae MS11	51.887	98.148	0.509
ssb	Neisseria meningitidis MC58	51.887	98.148	0.509
ssb	Vibrio cholerae strain A1552	54.639	89.815	0.491