Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | J5284_RS01560 | Genome accession | NZ_CP072172 |
| Coordinates | 311616..312122 (+) | Length | 168 a.a. |
| NCBI ID | WP_219511049.1 | Uniprot ID | - |
| Organism | Rhizobium sp. AB2/73 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 290356..327038 | 311616..312122 | within | 0 |
Gene organization within MGE regions
Location: 290356..327038
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J5284_RS01435 (J5284_01435) | - | 290356..290988 (-) | 633 | WP_219511006.1 | hypothetical protein | - |
| J5284_RS01440 (J5284_01440) | - | 291026..294340 (-) | 3315 | WP_219511007.1 | hypothetical protein | - |
| J5284_RS01445 (J5284_01445) | - | 294376..296241 (-) | 1866 | WP_219511009.1 | tape measure protein | - |
| J5284_RS34890 | - | 296281..296403 (-) | 123 | WP_257714001.1 | hypothetical protein | - |
| J5284_RS01450 (J5284_01450) | - | 296424..296828 (-) | 405 | WP_219511010.1 | gene transfer agent family protein | - |
| J5284_RS01455 (J5284_01455) | - | 296828..297280 (-) | 453 | WP_219511011.1 | phage tail tube protein | - |
| J5284_RS01460 (J5284_01460) | - | 297425..297829 (-) | 405 | WP_219511012.1 | hypothetical protein | - |
| J5284_RS01465 (J5284_01465) | - | 298062..298316 (-) | 255 | WP_219511014.1 | hypothetical protein | - |
| J5284_RS01470 (J5284_01470) | - | 298318..298698 (-) | 381 | WP_219511015.1 | HNH endonuclease | - |
| J5284_RS01475 (J5284_01475) | - | 298819..299637 (-) | 819 | WP_219511018.1 | hypothetical protein | - |
| J5284_RS01480 (J5284_01480) | - | 300029..301801 (-) | 1773 | WP_113397437.1 | phage/plasmid primase, P4 family | - |
| J5284_RS01485 (J5284_01485) | - | 301802..303049 (-) | 1248 | WP_219511020.1 | primase-helicase zinc-binding domain-containing protein | - |
| J5284_RS35475 (J5284_01490) | - | 303046..304146 (-) | 1101 | WP_219511022.1 | DNA cytosine methyltransferase | - |
| J5284_RS01495 (J5284_01495) | - | 304143..304478 (-) | 336 | WP_219511024.1 | hypothetical protein | - |
| J5284_RS01500 (J5284_01500) | - | 304478..304873 (-) | 396 | WP_219511027.1 | hypothetical protein | - |
| J5284_RS01505 (J5284_01505) | - | 304866..305885 (-) | 1020 | WP_219511029.1 | DNA methyltransferase | - |
| J5284_RS01510 (J5284_01510) | - | 305882..307270 (-) | 1389 | WP_219511032.1 | helicase | - |
| J5284_RS01515 (J5284_01515) | - | 307270..307929 (-) | 660 | WP_219511035.1 | GcrA family cell cycle regulator | - |
| J5284_RS01520 (J5284_01520) | - | 307926..308195 (-) | 270 | WP_219511036.1 | hypothetical protein | - |
| J5284_RS01525 (J5284_01525) | - | 308192..308662 (-) | 471 | WP_229002060.1 | phage regulatory CII family protein | - |
| J5284_RS01530 (J5284_01530) | - | 308782..308988 (-) | 207 | WP_112605555.1 | Cro/CI family transcriptional regulator | - |
| J5284_RS01535 (J5284_01535) | - | 309071..309763 (+) | 693 | WP_219511457.1 | helix-turn-helix transcriptional regulator | - |
| J5284_RS01540 (J5284_01540) | - | 310175..310408 (+) | 234 | WP_219511040.1 | hypothetical protein | - |
| J5284_RS01545 (J5284_01545) | - | 310418..310594 (+) | 177 | WP_219511042.1 | hypothetical protein | - |
| J5284_RS01550 (J5284_01550) | - | 310591..311262 (+) | 672 | WP_219511044.1 | hypothetical protein | - |
| J5284_RS01555 (J5284_01555) | - | 311263..311616 (+) | 354 | WP_219511046.1 | hypothetical protein | - |
| J5284_RS01560 (J5284_01560) | ssb | 311616..312122 (+) | 507 | WP_219511049.1 | single-stranded DNA-binding protein | Machinery gene |
| J5284_RS01565 (J5284_01565) | - | 312131..312496 (+) | 366 | WP_219511051.1 | hypothetical protein | - |
| J5284_RS01570 (J5284_01570) | dnaN | 312487..313626 (+) | 1140 | WP_219511053.1 | DNA polymerase III subunit beta | - |
| J5284_RS01575 (J5284_01575) | - | 313726..314175 (+) | 450 | WP_219511055.1 | hypothetical protein | - |
| J5284_RS01580 (J5284_01580) | - | 314175..314543 (+) | 369 | WP_219511057.1 | HNH endonuclease signature motif containing protein | - |
| J5284_RS01585 (J5284_01585) | - | 314545..314751 (+) | 207 | WP_219511058.1 | hypothetical protein | - |
| J5284_RS01590 (J5284_01590) | - | 314732..315781 (+) | 1050 | WP_219511061.1 | tyrosine-type recombinase/integrase | - |
| J5284_RS01600 (J5284_01600) | - | 315994..317088 (-) | 1095 | WP_069611245.1 | 2'-deoxycytidine 5'-triphosphate deaminase | - |
| J5284_RS01605 (J5284_01605) | - | 317283..318470 (+) | 1188 | WP_069611244.1 | O-succinylhomoserine sulfhydrylase | - |
| J5284_RS01610 (J5284_01610) | - | 318537..319250 (-) | 714 | WP_069611243.1 | DNA helicase | - |
| J5284_RS01615 (J5284_01615) | apaG | 319864..320256 (+) | 393 | WP_069611387.1 | Co2+/Mg2+ efflux protein ApaG | - |
| J5284_RS01620 (J5284_01620) | - | 320275..321264 (-) | 990 | WP_069611242.1 | Hsp33 family molecular chaperone | - |
| J5284_RS01625 (J5284_01625) | argF | 321313..322230 (-) | 918 | WP_069611241.1 | ornithine carbamoyltransferase | - |
| J5284_RS01630 (J5284_01630) | - | 322400..323599 (-) | 1200 | WP_069611240.1 | aspartate aminotransferase family protein | - |
| J5284_RS01635 (J5284_01635) | - | 324025..324552 (+) | 528 | WP_069611239.1 | GcrA family cell cycle regulator | - |
| J5284_RS01640 (J5284_01640) | phoB | 324743..325426 (-) | 684 | WP_004128368.1 | phosphate regulon transcriptional regulator PhoB | - |
| J5284_RS01645 (J5284_01645) | phoU | 325458..326171 (-) | 714 | WP_015338719.1 | phosphate signaling complex protein PhoU | - |
| J5284_RS01650 (J5284_01650) | pstB | 326223..327038 (-) | 816 | WP_069611238.1 | phosphate ABC transporter ATP-binding protein PstB | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18760.70 Da Isoelectric Point: 5.9684
>NTDB_id=550907 J5284_RS01560 WP_219511049.1 311616..312122(+) (ssb) [Rhizobium sp. AB2/73]
MAGYLNKVTLIGNLGADPEIRRTQDGRPIANLNLATAEQWRDKNTGERKERTEWHRIVIFNEQLAKIAEQFLEKGAKIYI
EGQLATRKWQDQNGQDRWSTEIVLQGFDAKLIMLNKKDGSGYRQGGNGAGDYGYDSDRAAGSSSSSSTRTSQTIGGNFSR
DLDDDIPF
MAGYLNKVTLIGNLGADPEIRRTQDGRPIANLNLATAEQWRDKNTGERKERTEWHRIVIFNEQLAKIAEQFLEKGAKIYI
EGQLATRKWQDQNGQDRWSTEIVLQGFDAKLIMLNKKDGSGYRQGGNGAGDYGYDSDRAAGSSSSSSTRTSQTIGGNFSR
DLDDDIPF
Nucleotide
Download Length: 507 bp
>NTDB_id=550907 J5284_RS01560 WP_219511049.1 311616..312122(+) (ssb) [Rhizobium sp. AB2/73]
ATGGCGGGATATCTCAACAAGGTCACGCTGATCGGCAATCTCGGCGCCGATCCGGAAATCCGCCGCACGCAGGATGGCCG
GCCCATTGCCAATCTCAACCTCGCCACGGCAGAGCAATGGCGCGACAAGAATACCGGTGAGCGCAAAGAGCGAACCGAGT
GGCACCGCATCGTCATCTTCAACGAGCAGCTGGCGAAGATCGCCGAGCAGTTCCTTGAGAAGGGCGCCAAGATCTACATC
GAGGGCCAGCTCGCCACCCGAAAATGGCAGGACCAGAACGGGCAGGACCGGTGGAGCACGGAAATCGTGCTGCAGGGCTT
CGATGCCAAGTTGATCATGCTGAACAAGAAGGACGGCTCCGGCTATCGCCAGGGCGGCAATGGCGCTGGCGACTATGGCT
ATGACAGCGACCGCGCCGCCGGCTCGTCCTCTTCATCCTCCACCCGAACATCGCAGACGATCGGCGGCAATTTCAGCCGC
GACCTCGACGATGACATTCCGTTCTGA
ATGGCGGGATATCTCAACAAGGTCACGCTGATCGGCAATCTCGGCGCCGATCCGGAAATCCGCCGCACGCAGGATGGCCG
GCCCATTGCCAATCTCAACCTCGCCACGGCAGAGCAATGGCGCGACAAGAATACCGGTGAGCGCAAAGAGCGAACCGAGT
GGCACCGCATCGTCATCTTCAACGAGCAGCTGGCGAAGATCGCCGAGCAGTTCCTTGAGAAGGGCGCCAAGATCTACATC
GAGGGCCAGCTCGCCACCCGAAAATGGCAGGACCAGAACGGGCAGGACCGGTGGAGCACGGAAATCGTGCTGCAGGGCTT
CGATGCCAAGTTGATCATGCTGAACAAGAAGGACGGCTCCGGCTATCGCCAGGGCGGCAATGGCGCTGGCGACTATGGCT
ATGACAGCGACCGCGCCGCCGGCTCGTCCTCTTCATCCTCCACCCGAACATCGCAGACGATCGGCGGCAATTTCAGCCGC
GACCTCGACGATGACATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
43.915 |
100 |
0.494 |
| ssb | Vibrio cholerae strain A1552 |
46.821 |
100 |
0.482 |
| ssb | Neisseria meningitidis MC58 |
37.079 |
100 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
37.079 |
100 |
0.393 |