Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   J5X95_RS01610 Genome accession   NZ_CP072120
Coordinates   326068..326445 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain GKT04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 321068..331445
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5X95_RS01570 (J5X95_01570) - 321566..322360 (+) 795 WP_076424968.1 YqhG family protein -
  J5X95_RS01575 (J5X95_01575) sinI 322537..322710 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J5X95_RS01580 (J5X95_01580) sinR 322744..323079 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J5X95_RS01585 (J5X95_01585) tasA 323127..323912 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  J5X95_RS01590 (J5X95_01590) sipW 323977..324561 (-) 585 WP_015240205.1 signal peptidase I SipW -
  J5X95_RS01595 (J5X95_01595) tapA 324533..325204 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  J5X95_RS01600 (J5X95_01600) - 325463..325792 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  J5X95_RS01605 (J5X95_01605) - 325832..326011 (-) 180 WP_003153093.1 YqzE family protein -
  J5X95_RS01610 (J5X95_01610) comGG 326068..326445 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  J5X95_RS01615 (J5X95_01615) comGF 326446..326946 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  J5X95_RS01620 (J5X95_01620) comGE 326855..327169 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  J5X95_RS01625 (J5X95_01625) comGD 327153..327590 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  J5X95_RS01630 (J5X95_01630) comGC 327580..327888 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  J5X95_RS01635 (J5X95_01635) comGB 327893..328930 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  J5X95_RS01640 (J5X95_01640) comGA 328917..329987 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  J5X95_RS01645 (J5X95_01645) - 330179..331129 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=550680 J5X95_RS01610 WP_012117980.1 326068..326445(-) (comGG) [Bacillus amyloliquefaciens strain GKT04]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=550680 J5X95_RS01610 WP_012117980.1 326068..326445(-) (comGG) [Bacillus amyloliquefaciens strain GKT04]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512