Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | J5X95_RS01575 | Genome accession | NZ_CP072120 |
| Coordinates | 322537..322710 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain GKT04 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 317537..327710
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J5X95_RS01560 (J5X95_01560) | gcvT | 318350..319450 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| J5X95_RS01565 (J5X95_01565) | - | 319874..321544 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| J5X95_RS01570 (J5X95_01570) | - | 321566..322360 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| J5X95_RS01575 (J5X95_01575) | sinI | 322537..322710 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| J5X95_RS01580 (J5X95_01580) | sinR | 322744..323079 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| J5X95_RS01585 (J5X95_01585) | tasA | 323127..323912 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| J5X95_RS01590 (J5X95_01590) | sipW | 323977..324561 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| J5X95_RS01595 (J5X95_01595) | tapA | 324533..325204 (-) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| J5X95_RS01600 (J5X95_01600) | - | 325463..325792 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| J5X95_RS01605 (J5X95_01605) | - | 325832..326011 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| J5X95_RS01610 (J5X95_01610) | comGG | 326068..326445 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| J5X95_RS01615 (J5X95_01615) | comGF | 326446..326946 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| J5X95_RS01620 (J5X95_01620) | comGE | 326855..327169 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| J5X95_RS01625 (J5X95_01625) | comGD | 327153..327590 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=550678 J5X95_RS01575 WP_003153105.1 322537..322710(+) (sinI) [Bacillus amyloliquefaciens strain GKT04]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=550678 J5X95_RS01575 WP_003153105.1 322537..322710(+) (sinI) [Bacillus amyloliquefaciens strain GKT04]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |