Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   J6L63_RS14365 Genome accession   NZ_CP072116
Coordinates   2867975..2868445 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain TCH32929     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2843907..2873491 2867975..2868445 within 0


Gene organization within MGE regions


Location: 2843907..2873491
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6L63_RS14205 (J6L63_14155) - 2843907..2844533 (-) 627 WP_244777060.1 nitroreductase family protein -
  J6L63_RS14210 (J6L63_14160) - 2844730..2845989 (+) 1260 WP_000120297.1 SdrH family protein -
  J6L63_RS14215 (J6L63_14165) mroQ 2846014..2846757 (-) 744 WP_000197630.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  J6L63_RS14220 (J6L63_14170) groES 2846932..2847216 (+) 285 WP_000917289.1 co-chaperone GroES -
  J6L63_RS14225 (J6L63_14175) groL 2847292..2848908 (+) 1617 WP_000240642.1 chaperonin GroEL -
  J6L63_RS14230 (J6L63_14180) - 2849448..2850755 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  J6L63_RS14235 (J6L63_14185) - 2851199..2852422 (-) 1224 WP_244777061.1 ArgE/DapE family deacylase -
  J6L63_RS14240 (J6L63_14190) lukH 2852858..2853913 (+) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  J6L63_RS14245 (J6L63_14195) lukG 2853935..2854951 (+) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  J6L63_RS14250 (J6L63_14200) sph 2855189..2856013 (-) 825 Protein_2768 sphingomyelin phosphodiesterase -
  J6L63_RS14255 (J6L63_14205) - 2856070..2857107 (-) 1038 WP_000857200.1 site-specific integrase -
  J6L63_RS14260 (J6L63_14210) - 2857298..2858011 (-) 714 WP_001582614.1 type II toxin-antitoxin system PemK/MazF family toxin -
  J6L63_RS14265 (J6L63_14215) - 2858090..2858272 (-) 183 WP_000705245.1 hypothetical protein -
  J6L63_RS14270 (J6L63_14220) - 2858343..2858528 (-) 186 WP_000109189.1 hypothetical protein -
  J6L63_RS14275 (J6L63_14225) - 2858525..2858671 (-) 147 WP_000345949.1 hypothetical protein -
  J6L63_RS14280 (J6L63_14230) - 2858745..2859599 (-) 855 WP_001557601.1 HIRAN domain-containing protein -
  J6L63_RS14285 (J6L63_14235) - 2859611..2860327 (-) 717 WP_001083975.1 LexA family transcriptional regulator -
  J6L63_RS14290 (J6L63_14240) - 2860491..2860733 (+) 243 WP_000639923.1 DUF739 family protein -
  J6L63_RS14295 (J6L63_14245) - 2860746..2861189 (+) 444 WP_000435360.1 hypothetical protein -
  J6L63_RS14300 (J6L63_14250) - 2861204..2861344 (+) 141 WP_000939495.1 hypothetical protein -
  J6L63_RS14305 (J6L63_14255) - 2861337..2861546 (-) 210 WP_000772137.1 hypothetical protein -
  J6L63_RS14310 (J6L63_14260) - 2861603..2862352 (+) 750 WP_001148338.1 phage antirepressor KilAC domain-containing protein -
  J6L63_RS14315 (J6L63_14265) - 2862368..2862565 (+) 198 WP_001148862.1 hypothetical protein -
  J6L63_RS14320 (J6L63_14270) - 2862552..2862932 (-) 381 WP_000762521.1 DUF2513 domain-containing protein -
  J6L63_RS14325 (J6L63_14275) - 2862987..2863310 (+) 324 WP_001120201.1 DUF771 domain-containing protein -
  J6L63_RS14330 (J6L63_14280) - 2863307..2863468 (+) 162 WP_000048129.1 DUF1270 family protein -
  J6L63_RS14335 (J6L63_14285) - 2863563..2863865 (+) 303 WP_000165371.1 DUF2482 family protein -
  J6L63_RS14340 (J6L63_14290) - 2863870..2864130 (+) 261 WP_000291510.1 DUF1108 family protein -
  J6L63_RS14345 (J6L63_14295) - 2864139..2864402 (+) 264 WP_001205732.1 hypothetical protein -
  J6L63_RS14350 (J6L63_14300) - 2864411..2866354 (+) 1944 WP_000700554.1 AAA family ATPase -
  J6L63_RS14355 (J6L63_14305) - 2866356..2867276 (+) 921 WP_000180600.1 recombinase RecT -
  J6L63_RS14360 (J6L63_14310) - 2867357..2867974 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  J6L63_RS14365 (J6L63_14315) ssbA 2867975..2868445 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  J6L63_RS14370 (J6L63_14320) - 2868475..2869368 (+) 894 WP_000148333.1 DnaD domain-containing protein -
  J6L63_RS14375 (J6L63_14325) - 2869375..2869593 (+) 219 WP_000338528.1 hypothetical protein -
  J6L63_RS14380 (J6L63_14330) - 2869602..2870006 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  J6L63_RS14385 (J6L63_14335) - 2870019..2870390 (+) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  J6L63_RS14390 (J6L63_14340) - 2870390..2870647 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  J6L63_RS14395 (J6L63_14345) - 2870650..2870892 (+) 243 WP_000221877.1 SAV1978 family virulence-associated passenger protein -
  J6L63_RS14400 (J6L63_14350) - 2870907..2871152 (+) 246 WP_001065108.1 DUF1024 family protein -
  J6L63_RS14405 (J6L63_14355) - 2871149..2871685 (+) 537 WP_000185693.1 dUTPase -
  J6L63_RS14410 (J6L63_14360) - 2871722..2871967 (+) 246 WP_001282077.1 hypothetical protein -
  J6L63_RS14415 (J6L63_14365) - 2871964..2872170 (+) 207 WP_000195784.1 DUF1381 domain-containing protein -
  J6L63_RS14420 (J6L63_14370) rinB 2872167..2872316 (+) 150 WP_000595265.1 transcriptional activator RinB -
  J6L63_RS14425 (J6L63_14375) - 2872316..2872516 (+) 201 WP_001557462.1 DUF1514 family protein -
  J6L63_RS14430 (J6L63_14380) - 2872544..2872960 (+) 417 WP_000590122.1 hypothetical protein -
  J6L63_RS14435 (J6L63_14385) - 2873192..2873491 (+) 300 WP_000988332.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=550608 J6L63_RS14365 WP_000934759.1 2867975..2868445(+) (ssbA) [Staphylococcus aureus strain TCH32929]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=550608 J6L63_RS14365 WP_000934759.1 2867975..2868445(+) (ssbA) [Staphylococcus aureus strain TCH32929]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365