Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   J5D23_RS00200 Genome accession   NZ_CP071987
Coordinates   38221..38334 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain MT5136     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 33221..43334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5D23_RS00175 (J5D23_00175) - 33262..35490 (+) 2229 WP_001978629.1 ATP-dependent Clp protease ATP-binding subunit -
  J5D23_RS00180 (J5D23_00180) panD 35480..35833 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  J5D23_RS00185 (J5D23_00185) - 35836..36138 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  J5D23_RS00190 (J5D23_00190) - 36138..37142 (+) 1005 WP_209554406.1 PDZ domain-containing protein -
  J5D23_RS00195 (J5D23_00195) comB6 37150..38205 (+) 1056 WP_209554404.1 P-type conjugative transfer protein TrbL Machinery gene
  J5D23_RS00200 (J5D23_00200) comB7 38221..38334 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  J5D23_RS00205 (J5D23_00205) comB8 38331..39074 (+) 744 WP_209613997.1 virB8 family protein Machinery gene
  J5D23_RS00210 (J5D23_00210) comB9 39074..40063 (+) 990 WP_209613998.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  J5D23_RS00215 (J5D23_00215) comB10 40056..41192 (+) 1137 WP_209613999.1 DNA type IV secretion system protein ComB10 Machinery gene
  J5D23_RS00220 (J5D23_00220) - 41262..42680 (+) 1419 WP_209614000.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=549747 J5D23_RS00200 WP_001217877.1 38221..38334(+) (comB7) [Helicobacter pylori strain MT5136]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=549747 J5D23_RS00200 WP_001217877.1 38221..38334(+) (comB7) [Helicobacter pylori strain MT5136]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACTTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973