Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   J4048_RS12725 Genome accession   NZ_CP071970
Coordinates   2638469..2638846 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain XJ5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2633469..2643846
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4048_RS12685 (J4048_12685) - 2633967..2634761 (+) 795 WP_007408330.1 YqhG family protein -
  J4048_RS12690 (J4048_12690) sinI 2634938..2635111 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J4048_RS12695 (J4048_12695) sinR 2635145..2635480 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J4048_RS12700 (J4048_12700) - 2635528..2636313 (-) 786 WP_007408329.1 TasA family protein -
  J4048_RS12705 (J4048_12705) - 2636378..2636962 (-) 585 WP_015240205.1 signal peptidase I -
  J4048_RS12710 (J4048_12710) tapA 2636934..2637605 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  J4048_RS12715 (J4048_12715) - 2637864..2638193 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  J4048_RS12720 (J4048_12720) - 2638233..2638412 (-) 180 WP_003153093.1 YqzE family protein -
  J4048_RS12725 (J4048_12725) comGG 2638469..2638846 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  J4048_RS12730 (J4048_12730) comGF 2638847..2639347 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  J4048_RS12735 (J4048_12735) comGE 2639256..2639570 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  J4048_RS12740 (J4048_12740) comGD 2639554..2639991 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  J4048_RS12745 (J4048_12745) comGC 2639981..2640289 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  J4048_RS12750 (J4048_12750) comGB 2640294..2641331 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  J4048_RS12755 (J4048_12755) comGA 2641318..2642388 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  J4048_RS12760 (J4048_12760) - 2642581..2643531 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=549497 J4048_RS12725 WP_015417814.1 2638469..2638846(-) (comGG) [Bacillus amyloliquefaciens strain XJ5]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=549497 J4048_RS12725 WP_015417814.1 2638469..2638846(-) (comGG) [Bacillus amyloliquefaciens strain XJ5]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504