Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | J4048_RS12690 | Genome accession | NZ_CP071970 |
| Coordinates | 2634938..2635111 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain XJ5 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2629938..2640111
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J4048_RS12675 (J4048_12675) | gcvT | 2630751..2631851 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| J4048_RS12680 (J4048_12680) | - | 2632275..2633945 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| J4048_RS12685 (J4048_12685) | - | 2633967..2634761 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| J4048_RS12690 (J4048_12690) | sinI | 2634938..2635111 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| J4048_RS12695 (J4048_12695) | sinR | 2635145..2635480 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| J4048_RS12700 (J4048_12700) | - | 2635528..2636313 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| J4048_RS12705 (J4048_12705) | - | 2636378..2636962 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| J4048_RS12710 (J4048_12710) | tapA | 2636934..2637605 (-) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| J4048_RS12715 (J4048_12715) | - | 2637864..2638193 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| J4048_RS12720 (J4048_12720) | - | 2638233..2638412 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| J4048_RS12725 (J4048_12725) | comGG | 2638469..2638846 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| J4048_RS12730 (J4048_12730) | comGF | 2638847..2639347 (-) | 501 | WP_257738552.1 | competence type IV pilus minor pilin ComGF | - |
| J4048_RS12735 (J4048_12735) | comGE | 2639256..2639570 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| J4048_RS12740 (J4048_12740) | comGD | 2639554..2639991 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=549495 J4048_RS12690 WP_003153105.1 2634938..2635111(+) (sinI) [Bacillus amyloliquefaciens strain XJ5]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=549495 J4048_RS12690 WP_003153105.1 2634938..2635111(+) (sinI) [Bacillus amyloliquefaciens strain XJ5]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |