Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LOZ87_RS11750 Genome accession   NZ_CP087391
Coordinates   2436860..2437237 (-) Length   125 a.a.
NCBI ID   WP_039063315.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ZF57     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2431860..2442237
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ87_RS11710 (LOZ87_11710) - 2432358..2433152 (+) 795 WP_007408330.1 YqhG family protein -
  LOZ87_RS11715 (LOZ87_11715) sinI 2433329..2433502 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOZ87_RS11720 (LOZ87_11720) sinR 2433536..2433871 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOZ87_RS11725 (LOZ87_11725) tasA 2433919..2434704 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LOZ87_RS11730 (LOZ87_11730) sipW 2434769..2435353 (-) 585 WP_007408328.1 signal peptidase I SipW -
  LOZ87_RS11735 (LOZ87_11735) tapA 2435325..2435996 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  LOZ87_RS11740 (LOZ87_11740) - 2436255..2436584 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  LOZ87_RS11745 (LOZ87_11745) - 2436624..2436803 (-) 180 WP_003153093.1 YqzE family protein -
  LOZ87_RS11750 (LOZ87_11750) comGG 2436860..2437237 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG Machinery gene
  LOZ87_RS11755 (LOZ87_11755) comGF 2437238..2437738 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  LOZ87_RS11760 (LOZ87_11760) comGE 2437647..2437961 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  LOZ87_RS11765 (LOZ87_11765) comGD 2437945..2438382 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  LOZ87_RS11770 (LOZ87_11770) comGC 2438372..2438680 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LOZ87_RS11775 (LOZ87_11775) comGB 2438685..2439722 (-) 1038 WP_039063317.1 competence type IV pilus assembly protein ComGB Machinery gene
  LOZ87_RS11780 (LOZ87_11780) comGA 2439709..2440779 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LOZ87_RS11785 (LOZ87_11785) - 2440972..2441922 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14183.99 Da        Isoelectric Point: 9.7381

>NTDB_id=545997 LOZ87_RS11750 WP_039063315.1 2436860..2437237(-) (comGG) [Bacillus amyloliquefaciens strain ZF57]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFNTRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=545997 LOZ87_RS11750 WP_039063315.1 2436860..2437237(-) (comGG) [Bacillus amyloliquefaciens strain ZF57]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCAACACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterProScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

48.387

99.2

0.48