Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JYA66_RS01520 Genome accession   NZ_CP071100
Coordinates   351472..351975 (+) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain PS/BAC/169/17/W     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 347409..392372 351472..351975 within 0


Gene organization within MGE regions


Location: 347409..392372
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JYA66_RS01490 (JYA66_000298) - 347409..348254 (+) 846 WP_001566903.1 ParB/RepB/Spo0J family partition protein -
  JYA66_RS01495 (JYA66_000299) - 348411..349292 (+) 882 WP_001077602.1 mechanosensitive ion channel family protein -
  JYA66_RS01500 (JYA66_000300) - 349322..349525 (+) 204 WP_000157349.1 DUF951 domain-containing protein -
  JYA66_RS01505 (JYA66_000301) ychF 349537..350634 (+) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  JYA66_RS01510 (JYA66_000302) - 350720..350911 (-) 192 WP_001052483.1 hypothetical protein -
  JYA66_RS01515 (JYA66_000303) rpsF 351155..351451 (+) 297 WP_001261460.1 30S ribosomal protein S6 -
  JYA66_RS01520 (JYA66_000304) ssbA 351472..351975 (+) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  JYA66_RS01525 (JYA66_000305) rpsR 352027..352269 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  JYA66_RS01530 (JYA66_000306) - 352502..353221 (-) 720 WP_000400841.1 type II toxin-antitoxin system PemK/MazF family toxin -
  JYA66_RS01535 (JYA66_000307) - 353334..354549 (-) 1216 Protein_306 tyrosine-type recombinase/integrase -
  JYA66_RS01540 (JYA66_000308) - 354710..355333 (-) 624 WP_000230361.1 helix-turn-helix transcriptional regulator -
  JYA66_RS01545 (JYA66_000309) - 355482..355646 (+) 165 WP_001611932.1 helix-turn-helix domain-containing protein -
  JYA66_RS01550 (JYA66_000310) - 355647..355919 (+) 273 WP_001138305.1 helix-turn-helix domain-containing protein -
  JYA66_RS01555 (JYA66_000311) - 355931..356104 (+) 174 WP_000784892.1 hypothetical protein -
  JYA66_RS01560 (JYA66_000312) - 356071..356274 (+) 204 WP_001231376.1 hypothetical protein -
  JYA66_RS01565 (JYA66_000313) - 356276..356659 (+) 384 WP_000403837.1 hypothetical protein -
  JYA66_RS01570 (JYA66_000314) - 356660..356986 (+) 327 WP_001103967.1 DUF1474 family protein -
  JYA66_RS01575 (JYA66_000315) - 357051..357920 (+) 870 WP_001002709.1 primase alpha helix C-terminal domain-containing protein -
  JYA66_RS01580 (JYA66_000316) - 357934..359646 (+) 1713 Protein_315 DUF927 domain-containing protein -
  JYA66_RS01585 (JYA66_000317) - 359957..360337 (+) 381 WP_000356942.1 hypothetical protein -
  JYA66_RS01590 (JYA66_000318) - 360334..360975 (+) 642 WP_001019762.1 hypothetical protein -
  JYA66_RS01595 (JYA66_000319) - 361683..362027 (+) 345 WP_001288442.1 hypothetical protein -
  JYA66_RS01600 (JYA66_000320) - 362058..362711 (+) 654 WP_000214170.1 hypothetical protein -
  JYA66_RS01605 (JYA66_000321) - 362764..363291 (+) 528 WP_000771361.1 spore coat protein -
  JYA66_RS01610 (JYA66_000322) - 363423..363635 (+) 213 WP_001656917.1 hypothetical protein -
  JYA66_RS01615 (JYA66_000323) - 363632..364201 (+) 570 WP_001293071.1 terminase small subunit -
  JYA66_RS13635 - 364248..364331 (+) 84 Protein_323 terminase small subunit -
  JYA66_RS01620 (JYA66_000324) - 364478..365446 (+) 969 WP_000801980.1 Abi family protein -
  JYA66_RS01625 (JYA66_000325) - 365590..366027 (+) 438 WP_073392942.1 DUF3102 domain-containing protein -
  JYA66_RS01630 (JYA66_000326) - 366145..366657 (+) 513 WP_000813311.1 hypothetical protein -
  JYA66_RS13640 - 366673..366852 (+) 180 WP_000797954.1 hypothetical protein -
  JYA66_RS01635 (JYA66_000327) - 367615..368622 (-) 1008 WP_001080636.1 Abi family protein -
  JYA66_RS01640 (JYA66_000328) - 368628..369328 (-) 701 Protein_329 site-specific integrase -
  JYA66_RS01645 (JYA66_000329) - 369565..369933 (+) 369 WP_000849169.1 YxeA family protein -
  JYA66_RS01650 (JYA66_000330) - 370114..370686 (+) 573 WP_000769720.1 PepSY domain-containing protein -
  JYA66_RS01655 (JYA66_000331) - 370824..371087 (-) 264 WP_001055897.1 helix-turn-helix transcriptional regulator -
  JYA66_RS01660 (JYA66_000332) - 371387..371638 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  JYA66_RS01665 (JYA66_000333) - 371677..371886 (-) 210 WP_000211676.1 hypothetical protein -
  JYA66_RS01670 (JYA66_000334) - 372064..372645 (+) 582 WP_000158374.1 histidine phosphatase family protein -
  JYA66_RS01675 (JYA66_000335) - 372711..373094 (-) 384 WP_000868251.1 hypothetical protein -
  JYA66_RS01680 (JYA66_000336) - 373349..373975 (-) 627 WP_000746687.1 NDxxF motif lipoprotein -
  JYA66_RS01685 (JYA66_000337) - 374048..374290 (-) 243 Protein_338 hypothetical protein -
  JYA66_RS01690 (JYA66_000338) ahpF 374420..375943 (-) 1524 WP_000930487.1 alkyl hydroperoxide reductase subunit F -
  JYA66_RS01695 (JYA66_000339) ahpC 375959..376528 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  JYA66_RS01700 (JYA66_000340) nfsA 377020..377775 (+) 756 WP_001289312.1 oxygen-insensitive NADPH nitroreductase -
  JYA66_RS01705 (JYA66_000341) - 377855..379243 (-) 1389 WP_000991020.1 L-cystine transporter -
  JYA66_RS01710 (JYA66_000342) - 379328..379426 (+) 99 WP_001792089.1 hypothetical protein -
  JYA66_RS01715 (JYA66_000343) - 380142..381098 (-) 957 WP_000956136.1 hypothetical protein -
  JYA66_RS01720 (JYA66_000344) - 381216..381878 (-) 663 WP_000394698.1 hypothetical protein -
  JYA66_RS01725 (JYA66_000345) - 382021..382428 (-) 408 WP_000763768.1 general stress protein -
  JYA66_RS01730 (JYA66_000346) xpt 382941..383519 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  JYA66_RS01735 (JYA66_000347) pbuX 383519..384787 (+) 1269 WP_000793023.1 xanthine permease PbuX -
  JYA66_RS01740 (JYA66_000348) guaB 384825..386291 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  JYA66_RS01745 (JYA66_000349) guaA 386316..387857 (+) 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
  JYA66_RS01750 (JYA66_000350) - 387970..388506 (-) 537 WP_000551776.1 hypothetical protein -
  JYA66_RS01755 (JYA66_000351) - 388875..389603 (-) 729 WP_211020267.1 type II toxin-antitoxin system PemK/MazF family toxin -
  JYA66_RS13645 - 390115..390228 (+) 114 Protein_353 pathogenicity island protein -
  JYA66_RS13650 - 390281..390684 (+) 404 Protein_354 mobile element-associated protein -
  JYA66_RS01760 (JYA66_000352) - 390753..391076 (-) 324 WP_211020269.1 transposase -
  JYA66_RS01765 (JYA66_000353) - 391337..391489 (-) 153 WP_000248850.1 hypothetical protein -
  JYA66_RS01770 (JYA66_000354) - 392013..392372 (-) 360 WP_001021621.1 DUF1304 domain-containing protein -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=542795 JYA66_RS01520 WP_000934799.1 351472..351975(+) (ssbA) [Staphylococcus aureus strain PS/BAC/169/17/W]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=542795 JYA66_RS01520 WP_000934799.1 351472..351975(+) (ssbA) [Staphylococcus aureus strain PS/BAC/169/17/W]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGTGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365