Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   JS608_RS14815 Genome accession   NZ_CP071042
Coordinates   3014025..3014402 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens isolate ELA1901024     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3009025..3019402
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS608_RS14775 (JS608_02957) - 3009524..3010318 (+) 795 WP_014305407.1 YqhG family protein -
  JS608_RS14780 (JS608_02958) sinI 3010495..3010668 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JS608_RS14785 (JS608_02959) sinR 3010702..3011037 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JS608_RS14790 (JS608_02960) tasA 3011085..3011870 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  JS608_RS14795 (JS608_02961) sipW 3011934..3012518 (-) 585 WP_003153100.1 signal peptidase I SipW -
  JS608_RS14800 (JS608_02962) tapA 3012490..3013161 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  JS608_RS14805 (JS608_02963) - 3013420..3013749 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JS608_RS14810 (JS608_02964) - 3013789..3013968 (-) 180 WP_003153093.1 YqzE family protein -
  JS608_RS14815 (JS608_02965) comGG 3014025..3014402 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  JS608_RS14820 (JS608_02966) comGF 3014403..3014903 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  JS608_RS14825 (JS608_02967) comGE 3014812..3015126 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  JS608_RS14830 (JS608_02968) comGD 3015110..3015547 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  JS608_RS14835 (JS608_02969) comGC 3015537..3015845 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JS608_RS14840 (JS608_02970) comGB 3015850..3016887 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  JS608_RS14845 (JS608_02971) comGA 3016874..3017944 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JS608_RS14850 (JS608_02972) - 3018136..3019086 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=542450 JS608_RS14815 WP_003153092.1 3014025..3014402(-) (comGG) [Bacillus amyloliquefaciens isolate ELA1901024]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=542450 JS608_RS14815 WP_003153092.1 3014025..3014402(-) (comGG) [Bacillus amyloliquefaciens isolate ELA1901024]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512