Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | JS608_RS14780 | Genome accession | NZ_CP071042 |
| Coordinates | 3010495..3010668 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens isolate ELA1901024 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3005495..3015668
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JS608_RS14765 (JS608_02955) | gcvT | 3006313..3007413 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| JS608_RS14770 (JS608_02956) | - | 3007836..3009506 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| JS608_RS14775 (JS608_02957) | - | 3009524..3010318 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| JS608_RS14780 (JS608_02958) | sinI | 3010495..3010668 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| JS608_RS14785 (JS608_02959) | sinR | 3010702..3011037 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| JS608_RS14790 (JS608_02960) | tasA | 3011085..3011870 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| JS608_RS14795 (JS608_02961) | sipW | 3011934..3012518 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| JS608_RS14800 (JS608_02962) | tapA | 3012490..3013161 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| JS608_RS14805 (JS608_02963) | - | 3013420..3013749 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| JS608_RS14810 (JS608_02964) | - | 3013789..3013968 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| JS608_RS14815 (JS608_02965) | comGG | 3014025..3014402 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| JS608_RS14820 (JS608_02966) | comGF | 3014403..3014903 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| JS608_RS14825 (JS608_02967) | comGE | 3014812..3015126 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| JS608_RS14830 (JS608_02968) | comGD | 3015110..3015547 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=542448 JS608_RS14780 WP_003153105.1 3010495..3010668(+) (sinI) [Bacillus amyloliquefaciens isolate ELA1901024]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=542448 JS608_RS14780 WP_003153105.1 3010495..3010668(+) (sinI) [Bacillus amyloliquefaciens isolate ELA1901024]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |