Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   JYG31_RS13345 Genome accession   NZ_CP070976
Coordinates   2588491..2588838 (-) Length   115 a.a.
NCBI ID   WP_095713273.1    Uniprot ID   -
Organism   Bacillus halotolerans strain MBH1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2583491..2593838
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JYG31_RS13300 (JYG31_13300) sinI 2584010..2584183 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  JYG31_RS13305 (JYG31_13305) sinR 2584217..2584552 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JYG31_RS13310 (JYG31_13310) tasA 2584639..2585424 (-) 786 WP_095713270.1 biofilm matrix protein TasA -
  JYG31_RS13315 (JYG31_13315) - 2585489..2586073 (-) 585 WP_213417735.1 signal peptidase I -
  JYG31_RS13320 (JYG31_13320) tapA 2586045..2586806 (-) 762 WP_213417736.1 amyloid fiber anchoring/assembly protein TapA -
  JYG31_RS13325 (JYG31_13325) - 2587084..2587407 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  JYG31_RS13330 (JYG31_13330) - 2587450..2587629 (-) 180 WP_003236949.1 YqzE family protein -
  JYG31_RS13335 (JYG31_13335) comGG 2587701..2588075 (-) 375 WP_188323133.1 competence type IV pilus minor pilin ComGG Machinery gene
  JYG31_RS13340 (JYG31_13340) comGF 2588076..2588465 (-) 390 WP_213417737.1 competence type IV pilus minor pilin ComGF Machinery gene
  JYG31_RS13345 (JYG31_13345) comGE 2588491..2588838 (-) 348 WP_095713273.1 competence type IV pilus minor pilin ComGE Machinery gene
  JYG31_RS13350 (JYG31_13350) comGD 2588822..2589253 (-) 432 WP_103672268.1 competence type IV pilus minor pilin ComGD Machinery gene
  JYG31_RS13355 (JYG31_13355) comGC 2589243..2589539 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  JYG31_RS13360 (JYG31_13360) comGB 2589553..2590590 (-) 1038 WP_213417738.1 competence type IV pilus assembly protein ComGB Machinery gene
  JYG31_RS13365 (JYG31_13365) comGA 2590577..2591647 (-) 1071 WP_213417739.1 competence protein ComGA Machinery gene
  JYG31_RS13370 (JYG31_13370) - 2591969..2592379 (-) 411 WP_185848827.1 CBS domain-containing protein -
  JYG31_RS13375 (JYG31_13375) - 2592442..2593395 (-) 954 WP_095713277.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13295.20 Da        Isoelectric Point: 4.6258

>NTDB_id=541740 JYG31_RS13345 WP_095713273.1 2588491..2588838(-) (comGE) [Bacillus halotolerans strain MBH1]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREMGYQLVNESIGKYMLTGKGNSSQTVSMNNSKYSMT
WEEEGEYQNVCITSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=541740 JYG31_RS13345 WP_095713273.1 2588491..2588838(-) (comGE) [Bacillus halotolerans strain MBH1]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTCTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGAGAGAAATGGGTTATCAGCTTGTCAATGAAA
GCATAGGCAAATATATGCTTACAGGAAAAGGAAATTCGTCGCAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCACATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

70.435

100

0.704