Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JYA71_RS17865 Genome accession   NZ_CP070939
Coordinates   3805304..3805747 (-) Length   147 a.a.
NCBI ID   WP_265859210.1    Uniprot ID   -
Organism   Clostridium botulinum strain ZJK-8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3773466..3815064 3805304..3805747 within 0


Gene organization within MGE regions


Location: 3773466..3815064
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JYA71_RS17655 (JYA71_17510) bilQ 3773466..3773903 (-) 438 WP_260535870.1 bilirubin utilization transcriptional regulator BilQ -
  JYA71_RS17660 (JYA71_17515) - 3774115..3775413 (-) 1299 WP_260535872.1 DEAD/DEAH box helicase -
  JYA71_RS17665 (JYA71_17520) - 3775744..3775896 (-) 153 WP_003373161.1 zinc-ribbon domain-containing protein -
  JYA71_RS17670 (JYA71_17525) - 3776272..3776847 (-) 576 WP_265859205.1 YdeI/OmpD-associated family protein -
  JYA71_RS17675 (JYA71_17530) rlmH 3777077..3777556 (-) 480 WP_260534853.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  JYA71_RS17680 (JYA71_17535) - 3777846..3778487 (-) 642 WP_260534855.1 lactate utilization protein -
  JYA71_RS17685 (JYA71_17540) - 3778891..3779388 (-) 498 WP_003374022.1 SEC-C metal-binding domain-containing protein -
  JYA71_RS17690 (JYA71_17545) - 3779451..3780242 (-) 792 WP_012450919.1 MBL fold metallo-hydrolase -
  JYA71_RS17695 (JYA71_17550) - 3780277..3781539 (-) 1263 WP_260534857.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  JYA71_RS17700 (JYA71_17555) - 3781933..3782472 (+) 540 WP_012449467.1 hypothetical protein -
  JYA71_RS17705 (JYA71_17560) - 3782649..3783125 (+) 477 WP_003373384.1 dUTP diphosphatase -
  JYA71_RS17710 (JYA71_17565) - 3783315..3783746 (+) 432 WP_003369607.1 DMT family transporter -
  JYA71_RS17715 (JYA71_17570) - 3783804..3784622 (+) 819 WP_260529759.1 MBL fold metallo-hydrolase -
  JYA71_RS17720 (JYA71_17575) - 3784756..3785961 (+) 1206 WP_012450935.1 S8 family serine peptidase -
  JYA71_RS17725 (JYA71_17580) - 3786067..3787203 (-) 1137 WP_265887203.1 peptidoglycan DD-metalloendopeptidase family protein -
  JYA71_RS17730 (JYA71_17585) - 3787430..3788419 (+) 990 WP_012449871.1 DnaD domain protein -
  JYA71_RS17735 (JYA71_17590) - 3788412..3789392 (+) 981 WP_260537231.1 ATP-binding protein -
  JYA71_RS17795 (JYA71_17650) - 3790592..3791176 (-) 585 WP_012451320.1 hypothetical protein -
  JYA71_RS17800 (JYA71_17655) - 3791340..3792584 (+) 1245 WP_260537838.1 NAD(P)/FAD-dependent oxidoreductase -
  JYA71_RS17805 (JYA71_17660) - 3792754..3793503 (-) 750 WP_041082189.1 acyl-[acyl-carrier-protein] thioesterase -
  JYA71_RS17810 (JYA71_17665) - 3793710..3793892 (-) 183 WP_003371961.1 DUF1858 domain-containing protein -
  JYA71_RS17815 (JYA71_17670) - 3793995..3795281 (-) 1287 WP_260537674.1 adenylosuccinate synthase -
  JYA71_RS17820 (JYA71_17675) - 3795505..3796677 (+) 1173 WP_265859207.1 NAD(P)-dependent malic enzyme -
  JYA71_RS17825 (JYA71_17680) proC 3797387..3798187 (-) 801 WP_260535317.1 pyrroline-5-carboxylate reductase -
  JYA71_RS17830 (JYA71_17685) - 3798402..3798755 (+) 354 WP_260535316.1 protein phosphatase -
  JYA71_RS17835 (JYA71_17690) - 3798777..3800117 (-) 1341 WP_003368893.1 replicative DNA helicase -
  JYA71_RS17840 (JYA71_17695) lonC 3800204..3802096 (-) 1893 WP_265859208.1 Lon family ATP-dependent protease -
  JYA71_RS17845 (JYA71_17700) rplI 3802112..3802555 (-) 444 WP_012425064.1 50S ribosomal protein L9 -
  JYA71_RS17850 (JYA71_17705) - 3802558..3804498 (-) 1941 WP_265859209.1 DHH family phosphoesterase -
  JYA71_RS17855 (JYA71_17710) - 3804523..3804843 (-) 321 WP_003374679.1 MazG-like family protein -
  JYA71_RS17860 (JYA71_17715) rpsR 3805031..3805282 (-) 252 WP_003369777.1 30S ribosomal protein S18 -
  JYA71_RS17865 (JYA71_17720) ssbA 3805304..3805747 (-) 444 WP_265859210.1 single-stranded DNA-binding protein Machinery gene
  JYA71_RS17870 (JYA71_17725) rpsF 3805761..3806048 (-) 288 WP_026072100.1 30S ribosomal protein S6 -
  JYA71_RS17875 (JYA71_17730) - 3806158..3806349 (-) 192 WP_003373736.1 DUF951 domain-containing protein -
  JYA71_RS17880 (JYA71_17735) - 3806349..3807242 (-) 894 WP_012451521.1 mechanosensitive ion channel family protein -
  JYA71_RS17885 (JYA71_17740) - 3807270..3807509 (-) 240 WP_041082208.1 DUF3343 domain-containing protein -
  JYA71_RS17890 (JYA71_17745) - 3807911..3808564 (+) 654 WP_017826772.1 LysE family transporter -
  JYA71_RS17895 (JYA71_17750) - 3808580..3809737 (+) 1158 WP_265859211.1 aminotransferase class V-fold PLP-dependent enzyme -
  JYA71_RS17900 (JYA71_17755) yyaC 3810039..3810641 (+) 603 WP_017826774.1 spore protease YyaC -
  JYA71_RS17905 (JYA71_17760) - 3810938..3811456 (-) 519 WP_003374247.1 DUF4446 family protein -
  JYA71_RS17910 (JYA71_17765) - 3811497..3812375 (-) 879 WP_265859212.1 ParB/RepB/Spo0J family partition protein -
  JYA71_RS17915 (JYA71_17770) - 3812389..3813153 (-) 765 WP_003371151.1 ParA family protein -
  JYA71_RS17920 (JYA71_17775) noc 3813332..3814114 (-) 783 WP_003369619.1 nucleoid occlusion protein -
  JYA71_RS17925 (JYA71_17780) rsmG 3814345..3815064 (-) 720 WP_265859213.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16095.81 Da        Isoelectric Point: 4.5882

>NTDB_id=541464 JYA71_RS17865 WP_265859210.1 3805304..3805747(-) (ssbA) [Clostridium botulinum strain ZJK-8]
MNKVVLIGRLTKDPELRFTPGAGTAVTTLTLAVDKYNSKSGQKEADFVPVVVWGKQAESTANYMSKGSQMAISGRIQTRN
YEAKDGTKRYVTEVVATEVQFLSKSNASGNVGTNYSNNTEYSSSNNPFDDMNFEEDITPVDDGDMPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=541464 JYA71_RS17865 WP_265859210.1 3805304..3805747(-) (ssbA) [Clostridium botulinum strain ZJK-8]
ATGAACAAAGTAGTTTTAATCGGAAGATTGACGAAAGATCCAGAACTAAGATTTACTCCTGGAGCTGGAACAGCAGTAAC
TACCTTAACATTAGCAGTTGATAAGTATAATTCTAAATCTGGTCAAAAAGAAGCGGACTTTGTACCTGTAGTTGTATGGG
GAAAACAAGCTGAAAGTACTGCGAATTACATGAGTAAGGGTAGCCAAATGGCTATAAGCGGTAGAATTCAAACCAGAAAT
TATGAAGCAAAAGATGGAACAAAGAGATATGTTACAGAAGTAGTTGCTACAGAAGTTCAATTTTTAAGTAAATCAAATGC
TTCAGGAAATGTTGGTACTAATTATAGTAACAACACTGAATATTCATCATCAAATAATCCATTTGATGATATGAACTTTG
AAGAAGACATAACTCCAGTAGATGATGGAGATATGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

42.442

100

0.497

  ssbA Streptococcus mutans UA159

43.165

94.558

0.408

  ssb Latilactobacillus sakei subsp. sakei 23K

41.606

93.197

0.388

  ssbB Bacillus subtilis subsp. subtilis str. 168

53.398

70.068

0.374