Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JW302_RS06060 | Genome accession | NZ_CP070572 |
| Coordinates | 1301163..1301702 (-) | Length | 179 a.a. |
| NCBI ID | WP_110144533.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain PM52808 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1296829..1346157 | 1301163..1301702 | within | 0 |
Gene organization within MGE regions
Location: 1296829..1346157
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JW302_RS06025 (JW302_06025) | - | 1296829..1297830 (-) | 1002 | WP_026164649.1 | tyrosine-type recombinase/integrase | - |
| JW302_RS06030 (JW302_06030) | - | 1297787..1298032 (-) | 246 | WP_004247454.1 | excisionase | - |
| JW302_RS06035 (JW302_06035) | - | 1298029..1298367 (-) | 339 | WP_049216772.1 | phage protein NinX family protein | - |
| JW302_RS06040 (JW302_06040) | - | 1298360..1298536 (-) | 177 | WP_012367596.1 | hypothetical protein | - |
| JW302_RS06045 (JW302_06045) | - | 1298743..1299426 (-) | 684 | WP_162617415.1 | hypothetical protein | - |
| JW302_RS06050 (JW302_06050) | - | 1299543..1300226 (-) | 684 | WP_087726682.1 | hypothetical protein | - |
| JW302_RS20275 | - | 1300289..1300876 (-) | 588 | WP_232467332.1 | Rha family transcriptional regulator | - |
| JW302_RS06060 (JW302_06060) | ssb | 1301163..1301702 (-) | 540 | WP_110144533.1 | single-stranded DNA-binding protein | Machinery gene |
| JW302_RS06065 (JW302_06065) | - | 1301692..1302576 (-) | 885 | WP_087726680.1 | ATP-binding protein | - |
| JW302_RS06070 (JW302_06070) | - | 1302578..1302898 (-) | 321 | WP_017628824.1 | hypothetical protein | - |
| JW302_RS06075 (JW302_06075) | - | 1302895..1303047 (-) | 153 | WP_017628823.1 | hypothetical protein | - |
| JW302_RS06080 (JW302_06080) | - | 1303044..1303250 (-) | 207 | WP_236545617.1 | hypothetical protein | - |
| JW302_RS06085 (JW302_06085) | - | 1303315..1303470 (-) | 156 | WP_175246659.1 | hypothetical protein | - |
| JW302_RS06090 (JW302_06090) | - | 1303559..1303786 (-) | 228 | WP_012367608.1 | hypothetical protein | - |
| JW302_RS06095 (JW302_06095) | - | 1303909..1304184 (-) | 276 | WP_121909704.1 | hypothetical protein | - |
| JW302_RS06100 (JW302_06100) | - | 1304349..1304534 (+) | 186 | WP_004247469.1 | hypothetical protein | - |
| JW302_RS06105 (JW302_06105) | - | 1304531..1304683 (-) | 153 | WP_004247470.1 | hypothetical protein | - |
| JW302_RS06110 (JW302_06110) | - | 1304869..1305084 (+) | 216 | WP_049237116.1 | hypothetical protein | - |
| JW302_RS06115 (JW302_06115) | - | 1305081..1305296 (-) | 216 | WP_036907950.1 | hypothetical protein | - |
| JW302_RS06120 (JW302_06120) | - | 1305305..1305622 (-) | 318 | WP_017827445.1 | hypothetical protein | - |
| JW302_RS06125 (JW302_06125) | - | 1305987..1306352 (-) | 366 | WP_036908285.1 | hypothetical protein | - |
| JW302_RS06130 (JW302_06130) | - | 1306349..1307128 (-) | 780 | WP_036908283.1 | hypothetical protein | - |
| JW302_RS06135 (JW302_06135) | - | 1307163..1307846 (-) | 684 | WP_109023854.1 | LexA family transcriptional regulator | - |
| JW302_RS06140 (JW302_06140) | - | 1307929..1308138 (+) | 210 | WP_004245989.1 | helix-turn-helix transcriptional regulator | - |
| JW302_RS06145 (JW302_06145) | - | 1308284..1308631 (+) | 348 | WP_004247478.1 | hypothetical protein | - |
| JW302_RS06150 (JW302_06150) | - | 1308727..1308900 (+) | 174 | WP_004251793.1 | hypothetical protein | - |
| JW302_RS06155 (JW302_06155) | - | 1308897..1309664 (+) | 768 | WP_121909410.1 | helix-turn-helix domain-containing protein | - |
| JW302_RS06160 (JW302_06160) | - | 1309664..1311049 (+) | 1386 | WP_121909412.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| JW302_RS06165 (JW302_06165) | - | 1311075..1311524 (+) | 450 | WP_049195179.1 | YbcN family protein | - |
| JW302_RS06170 (JW302_06170) | - | 1311603..1311893 (+) | 291 | WP_004245984.1 | DUF1364 domain-containing protein | - |
| JW302_RS06175 (JW302_06175) | - | 1311890..1312246 (+) | 357 | WP_004245983.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JW302_RS06180 (JW302_06180) | - | 1312246..1312878 (+) | 633 | WP_004245982.1 | bacteriophage antitermination protein Q | - |
| JW302_RS06185 (JW302_06185) | - | 1313190..1313711 (+) | 522 | WP_004247148.1 | DUF1440 domain-containing protein | - |
| JW302_RS06190 (JW302_06190) | - | 1313870..1314292 (+) | 423 | WP_004247488.1 | hypothetical protein | - |
| JW302_RS06195 (JW302_06195) | - | 1314346..1314615 (+) | 270 | WP_036905789.1 | bacteriophage protein | - |
| JW302_RS06200 (JW302_06200) | - | 1314615..1315085 (+) | 471 | WP_017628809.1 | lysozyme | - |
| JW302_RS06205 (JW302_06205) | - | 1315067..1315225 (+) | 159 | WP_012367623.1 | hypothetical protein | - |
| JW302_RS06210 (JW302_06210) | - | 1315228..1315689 (+) | 462 | WP_012367624.1 | lysis protein | - |
| JW302_RS06215 (JW302_06215) | - | 1316044..1316580 (+) | 537 | WP_014657891.1 | KilA-N domain-containing protein | - |
| JW302_RS06220 (JW302_06220) | - | 1316750..1316995 (+) | 246 | WP_240349985.1 | hypothetical protein | - |
| JW302_RS06225 (JW302_06225) | - | 1316992..1317147 (+) | 156 | WP_175246660.1 | hypothetical protein | - |
| JW302_RS06230 (JW302_06230) | - | 1317207..1317434 (-) | 228 | WP_192176765.1 | hypothetical protein | - |
| JW302_RS06235 (JW302_06235) | - | 1317502..1318068 (+) | 567 | WP_121909230.1 | terminase small subunit | - |
| JW302_RS06240 (JW302_06240) | - | 1318065..1319639 (+) | 1575 | WP_121909229.1 | terminase | - |
| JW302_RS06245 (JW302_06245) | - | 1319639..1321009 (+) | 1371 | WP_121909228.1 | DUF4055 domain-containing protein | - |
| JW302_RS06250 (JW302_06250) | - | 1321006..1322127 (+) | 1122 | WP_121909227.1 | phage minor head protein | - |
| JW302_RS06255 (JW302_06255) | - | 1322197..1322442 (+) | 246 | WP_004247499.1 | hypothetical protein | - |
| JW302_RS06260 (JW302_06260) | - | 1322539..1323300 (+) | 762 | WP_004247500.1 | hypothetical protein | - |
| JW302_RS06265 (JW302_06265) | - | 1323314..1324267 (+) | 954 | WP_004247501.1 | major capsid protein | - |
| JW302_RS06270 (JW302_06270) | - | 1324321..1324554 (+) | 234 | WP_228766817.1 | Ig-like domain-containing protein | - |
| JW302_RS06275 (JW302_06275) | - | 1324594..1325073 (+) | 480 | WP_004245968.1 | DnaT-like ssDNA-binding protein | - |
| JW302_RS06280 (JW302_06280) | - | 1325076..1325426 (+) | 351 | WP_004247502.1 | hypothetical protein | - |
| JW302_RS06285 (JW302_06285) | - | 1325428..1326009 (+) | 582 | WP_004245966.1 | hypothetical protein | - |
| JW302_RS06290 (JW302_06290) | - | 1326045..1326407 (+) | 363 | WP_240349986.1 | phage tail terminator-like protein | - |
| JW302_RS06295 (JW302_06295) | - | 1326452..1327108 (+) | 657 | WP_121909225.1 | phage tail tube protein | - |
| JW302_RS06300 (JW302_06300) | - | 1327160..1327465 (+) | 306 | WP_004245960.1 | phage tail assembly chaperone | - |
| JW302_RS06305 (JW302_06305) | - | 1327480..1327767 (+) | 288 | WP_051008871.1 | DUF1799 domain-containing protein | - |
| JW302_RS06310 (JW302_06310) | - | 1327796..1328002 (-) | 207 | WP_004247508.1 | hypothetical protein | - |
| JW302_RS06315 (JW302_06315) | - | 1328155..1328526 (+) | 372 | WP_004247509.1 | hypothetical protein | - |
| JW302_RS06320 (JW302_06320) | - | 1328540..1328722 (-) | 183 | WP_004247510.1 | hypothetical protein | - |
| JW302_RS06325 (JW302_06325) | - | 1329057..1330058 (+) | 1002 | WP_109880200.1 | hypothetical protein | - |
| JW302_RS06330 (JW302_06330) | - | 1330331..1331164 (-) | 834 | WP_046334559.1 | phage antirepressor N-terminal domain-containing protein | - |
| JW302_RS06335 (JW302_06335) | - | 1331234..1331395 (-) | 162 | WP_004245955.1 | toxin-antitoxin system HicB family antitoxin | - |
| JW302_RS06340 (JW302_06340) | - | 1331509..1331766 (+) | 258 | WP_046334560.1 | Arc family DNA-binding protein | - |
| JW302_RS06345 (JW302_06345) | - | 1331763..1332656 (+) | 894 | WP_049257266.1 | DNA translocase FtsK | - |
| JW302_RS06350 (JW302_06350) | - | 1332694..1333563 (+) | 870 | WP_046334561.1 | hypothetical protein | - |
| JW302_RS06355 (JW302_06355) | - | 1333623..1336553 (+) | 2931 | WP_121909283.1 | phage tail tape measure protein | - |
| JW302_RS06360 (JW302_06360) | - | 1336565..1336855 (+) | 291 | WP_121909285.1 | hypothetical protein | - |
| JW302_RS20500 | - | 1336946..1337074 (-) | 129 | WP_258165012.1 | hypothetical protein | - |
| JW302_RS06370 (JW302_06370) | - | 1337218..1337559 (+) | 342 | WP_004247516.1 | phage tail protein | - |
| JW302_RS06375 (JW302_06375) | - | 1337556..1338299 (+) | 744 | WP_004247517.1 | phage minor tail protein L | - |
| JW302_RS06380 (JW302_06380) | - | 1338296..1339006 (+) | 711 | WP_004247518.1 | C40 family peptidase | - |
| JW302_RS06385 (JW302_06385) | - | 1339003..1339608 (+) | 606 | WP_004247519.1 | tail assembly protein | - |
| JW302_RS06390 (JW302_06390) | - | 1339660..1343853 (+) | 4194 | WP_004247520.1 | DUF1983 domain-containing protein | - |
| JW302_RS06395 (JW302_06395) | - | 1343859..1344215 (+) | 357 | WP_223307229.1 | hypothetical protein | - |
| JW302_RS06400 (JW302_06400) | - | 1344217..1344831 (+) | 615 | WP_004247523.1 | hypothetical protein | - |
| JW302_RS06405 (JW302_06405) | - | 1344881..1345141 (+) | 261 | WP_004247524.1 | hypothetical protein | - |
| JW302_RS20280 | - | 1345281..1345520 (+) | 240 | WP_166470157.1 | hypothetical protein | - |
| JW302_RS20505 | - | 1345707..1345829 (+) | 123 | WP_260426056.1 | hypothetical protein | - |
| JW302_RS06415 (JW302_06415) | - | 1345852..1346157 (-) | 306 | WP_004247526.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 179 a.a. Molecular weight: 19724.07 Da Isoelectric Point: 6.7138
>NTDB_id=540775 JW302_RS06060 WP_110144533.1 1301163..1301702(-) (ssb) [Proteus mirabilis strain PM52808]
MASKGVNKCILIGHLGQDPEIRYMPSGGAIANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNVGGSMQMLGGNGGNQAGSQKSQQNQGWGQPQQPQAQKQASSNQTPQSEPPMDFED
DIPFAPIGLPYPRHAIYVI
MASKGVNKCILIGHLGQDPEIRYMPSGGAIANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNVGGSMQMLGGNGGNQAGSQKSQQNQGWGQPQQPQAQKQASSNQTPQSEPPMDFED
DIPFAPIGLPYPRHAIYVI
Nucleotide
Download Length: 540 bp
>NTDB_id=540775 JW302_RS06060 WP_110144533.1 1301163..1301702(-) (ssb) [Proteus mirabilis strain PM52808]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAATCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTGTGCATCTTCGGCAAATTAGCAGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAAGTATATATC
GAAGGTTCTCTGCAAACCAGAAAATGGCAAGACCAAAGCGGGCAAGACCGATACACAACGGAAGTGGTAGTTAATGTCGG
CGGTTCTATGCAGATGTTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGTCACAGCAGAATCAAGGATGGGGAC
AACCTCAGCAACCGCAAGCGCAAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAGCCTCCGATGGATTTTGAGGAT
GATATCCCCTTCGCCCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAATCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTGTGCATCTTCGGCAAATTAGCAGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAAGTATATATC
GAAGGTTCTCTGCAAACCAGAAAATGGCAAGACCAAAGCGGGCAAGACCGATACACAACGGAAGTGGTAGTTAATGTCGG
CGGTTCTATGCAGATGTTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGTCACAGCAGAATCAAGGATGGGGAC
AACCTCAGCAACCGCAAGCGCAAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAGCCTCCGATGGATTTTGAGGAT
GATATCCCCTTCGCCCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
68.927 |
98.883 |
0.682 |
| ssb | Glaesserella parasuis strain SC1401 |
52.151 |
100 |
0.542 |
| ssb | Neisseria gonorrhoeae MS11 |
42.458 |
100 |
0.425 |
| ssb | Neisseria meningitidis MC58 |
42.458 |
100 |
0.425 |