Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JWZ98_RS11190 | Genome accession | NZ_CP070494 |
| Coordinates | 2387094..2387495 (+) | Length | 133 a.a. |
| NCBI ID | WP_205454307.1 | Uniprot ID | - |
| Organism | Methylomonas sp. EFPC1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2374595..2418679 | 2387094..2387495 | within | 0 |
Gene organization within MGE regions
Location: 2374595..2418679
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JWZ98_RS11105 (JWZ98_11105) | - | 2374595..2375107 (+) | 513 | WP_205454293.1 | phosphatidylglycerophosphatase A | - |
| JWZ98_RS11110 (JWZ98_11110) | - | 2375284..2376114 (+) | 831 | WP_205454294.1 | heme-binding protein | - |
| JWZ98_RS11120 (JWZ98_11120) | - | 2376684..2376989 (+) | 306 | WP_205454295.1 | flavodoxin domain-containing protein | - |
| JWZ98_RS11125 (JWZ98_11125) | - | 2377095..2377688 (-) | 594 | WP_205454296.1 | phage virion morphogenesis protein | - |
| JWZ98_RS11130 (JWZ98_11130) | - | 2377796..2379076 (-) | 1281 | WP_205454297.1 | PBECR2 nuclease fold domain-containing protein | - |
| JWZ98_RS11135 (JWZ98_11135) | - | 2379073..2379393 (-) | 321 | WP_205454298.1 | hypothetical protein | - |
| JWZ98_RS11140 (JWZ98_11140) | - | 2379390..2380976 (-) | 1587 | WP_205454299.1 | DUF935 family protein | - |
| JWZ98_RS11145 (JWZ98_11145) | terL | 2381181..2382881 (-) | 1701 | WP_205454300.1 | phage terminase large subunit | - |
| JWZ98_RS11150 (JWZ98_11150) | - | 2382884..2383690 (-) | 807 | WP_205454301.1 | hypothetical protein | - |
| JWZ98_RS11155 (JWZ98_11155) | - | 2383705..2384199 (-) | 495 | WP_026600528.1 | DUF1804 family protein | - |
| JWZ98_RS11160 (JWZ98_11160) | - | 2384212..2384541 (-) | 330 | WP_026600527.1 | hypothetical protein | - |
| JWZ98_RS11165 (JWZ98_11165) | - | 2384538..2384873 (-) | 336 | WP_205454302.1 | hypothetical protein | - |
| JWZ98_RS11170 (JWZ98_11170) | - | 2385055..2385690 (+) | 636 | WP_205454303.1 | hypothetical protein | - |
| JWZ98_RS11175 (JWZ98_11175) | - | 2385694..2385960 (+) | 267 | WP_205454304.1 | hypothetical protein | - |
| JWZ98_RS11180 (JWZ98_11180) | - | 2385957..2386655 (+) | 699 | WP_205454305.1 | DUF2786 domain-containing protein | - |
| JWZ98_RS11185 (JWZ98_11185) | - | 2386803..2386982 (+) | 180 | WP_205454306.1 | hypothetical protein | - |
| JWZ98_RS23400 | - | 2386979..2387104 (+) | 126 | WP_275899210.1 | hypothetical protein | - |
| JWZ98_RS11190 (JWZ98_11190) | ssb | 2387094..2387495 (+) | 402 | WP_205454307.1 | single-stranded DNA-binding protein | Machinery gene |
| JWZ98_RS11195 (JWZ98_11195) | - | 2387517..2387684 (+) | 168 | WP_205454308.1 | hypothetical protein | - |
| JWZ98_RS11200 (JWZ98_11200) | - | 2387788..2388276 (-) | 489 | WP_205454309.1 | hypothetical protein | - |
| JWZ98_RS11205 (JWZ98_11205) | - | 2388383..2388724 (-) | 342 | WP_205454310.1 | hypothetical protein | - |
| JWZ98_RS11210 (JWZ98_11210) | - | 2388772..2389212 (-) | 441 | WP_205454311.1 | hypothetical protein | - |
| JWZ98_RS11215 (JWZ98_11215) | - | 2389209..2389475 (-) | 267 | WP_205454312.1 | hypothetical protein | - |
| JWZ98_RS11220 (JWZ98_11220) | - | 2389472..2389924 (-) | 453 | WP_205454313.1 | helix-turn-helix transcriptional regulator | - |
| JWZ98_RS11225 (JWZ98_11225) | - | 2390007..2390210 (+) | 204 | WP_205454314.1 | hypothetical protein | - |
| JWZ98_RS11230 (JWZ98_11230) | - | 2390203..2391375 (+) | 1173 | WP_205454315.1 | hypothetical protein | - |
| JWZ98_RS11235 (JWZ98_11235) | - | 2391526..2391780 (+) | 255 | WP_205454316.1 | DUF3850 domain-containing protein | - |
| JWZ98_RS11240 (JWZ98_11240) | - | 2392008..2392271 (+) | 264 | WP_205454317.1 | phage protease | - |
| JWZ98_RS11245 (JWZ98_11245) | - | 2392291..2392938 (+) | 648 | WP_205454318.1 | Mu-like prophage major head subunit gpT family protein | - |
| JWZ98_RS11250 (JWZ98_11250) | - | 2392974..2393690 (+) | 717 | WP_205454319.1 | hypothetical protein | - |
| JWZ98_RS11255 (JWZ98_11255) | - | 2393690..2394193 (+) | 504 | WP_205454320.1 | phage protein Gp36 family protein | - |
| JWZ98_RS11260 (JWZ98_11260) | - | 2394193..2394675 (+) | 483 | WP_205454321.1 | hypothetical protein | - |
| JWZ98_RS11265 (JWZ98_11265) | - | 2394672..2396135 (+) | 1464 | WP_205454322.1 | hypothetical protein | - |
| JWZ98_RS11270 (JWZ98_11270) | - | 2396248..2396613 (+) | 366 | WP_205454323.1 | phage tail tube protein | - |
| JWZ98_RS11275 (JWZ98_11275) | - | 2396622..2398043 (+) | 1422 | WP_205454324.1 | hypothetical protein | - |
| JWZ98_RS11280 (JWZ98_11280) | - | 2398070..2398372 (+) | 303 | WP_205454325.1 | phage tail assembly protein | - |
| JWZ98_RS11285 (JWZ98_11285) | - | 2398598..2400577 (+) | 1980 | WP_205454326.1 | phage tail tape measure protein | - |
| JWZ98_RS11290 (JWZ98_11290) | - | 2400577..2401743 (+) | 1167 | WP_205454327.1 | DNA circularization N-terminal domain-containing protein | - |
| JWZ98_RS11295 (JWZ98_11295) | - | 2401736..2402785 (+) | 1050 | WP_205454328.1 | phage baseplate assembly protein | - |
| JWZ98_RS11300 (JWZ98_11300) | - | 2402766..2403266 (+) | 501 | WP_205454329.1 | phage baseplate assembly protein | - |
| JWZ98_RS11305 (JWZ98_11305) | - | 2403268..2403456 (+) | 189 | WP_205454330.1 | hypothetical protein | - |
| JWZ98_RS11310 (JWZ98_11310) | - | 2403450..2403845 (+) | 396 | WP_205454331.1 | phage GP46 family protein | - |
| JWZ98_RS11315 (JWZ98_11315) | - | 2403842..2404888 (+) | 1047 | WP_205454332.1 | baseplate J/gp47 family protein | - |
| JWZ98_RS11320 (JWZ98_11320) | - | 2404888..2405463 (+) | 576 | WP_205454333.1 | hypothetical protein | - |
| JWZ98_RS11325 (JWZ98_11325) | - | 2405456..2406295 (+) | 840 | WP_205454334.1 | hypothetical protein | - |
| JWZ98_RS11330 (JWZ98_11330) | - | 2406298..2406849 (+) | 552 | WP_026600485.1 | hypothetical protein | - |
| JWZ98_RS11340 (JWZ98_11340) | - | 2407134..2407895 (+) | 762 | WP_205450311.1 | DNA adenine methylase | - |
| JWZ98_RS11345 (JWZ98_11345) | - | 2408077..2409117 (+) | 1041 | WP_205454335.1 | alpha/beta hydrolase | - |
| JWZ98_RS11350 (JWZ98_11350) | - | 2409184..2410053 (+) | 870 | WP_240348324.1 | AraC family transcriptional regulator | - |
| JWZ98_RS23405 | - | 2410385..2410519 (+) | 135 | WP_275899211.1 | hypothetical protein | - |
| JWZ98_RS23170 (JWZ98_11355) | - | 2410574..2410729 (+) | 156 | WP_346015199.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JWZ98_RS11360 (JWZ98_11360) | - | 2410726..2411028 (+) | 303 | WP_205454337.1 | XRE family transcriptional regulator | - |
| JWZ98_RS11365 (JWZ98_11365) | - | 2411210..2412709 (+) | 1500 | WP_205454338.1 | helix-turn-helix domain-containing protein | - |
| JWZ98_RS11370 (JWZ98_11370) | istA | 2412594..2414147 (+) | 1554 | WP_240347962.1 | IS21 family transposase | - |
| JWZ98_RS23410 | - | 2414137..2414259 (+) | 123 | WP_275899109.1 | hypothetical protein | - |
| JWZ98_RS11375 (JWZ98_11375) | istB | 2414274..2414903 (+) | 630 | Protein_2249 | IS21-like element helper ATPase IstB | - |
| JWZ98_RS11380 (JWZ98_11380) | - | 2414969..2415952 (-) | 984 | Protein_2250 | IS256 family transposase | - |
| JWZ98_RS11385 (JWZ98_11385) | - | 2416081..2417178 (+) | 1098 | WP_205451336.1 | IS5 family transposase | - |
| JWZ98_RS11390 (JWZ98_11390) | - | 2417444..2418679 (-) | 1236 | WP_033156311.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 133 a.a. Molecular weight: 15207.08 Da Isoelectric Point: 7.2031
>NTDB_id=540204 JWZ98_RS11190 WP_205454307.1 2387094..2387495(+) (ssb) [Methylomonas sp. EFPC1]
MLNKVQLIGRLGGDPDVRYLPDGTATATINLATTRRWKDRNTQERKEETEWHRVVFFSGLADIAKQYLAKGAQIYVEGRL
KTRKWQGHDNQERYTTEIIANDMKMLSGKKDSPAQNPNIPPTAADDFDDEIPF
MLNKVQLIGRLGGDPDVRYLPDGTATATINLATTRRWKDRNTQERKEETEWHRVVFFSGLADIAKQYLAKGAQIYVEGRL
KTRKWQGHDNQERYTTEIIANDMKMLSGKKDSPAQNPNIPPTAADDFDDEIPF
Nucleotide
Download Length: 402 bp
>NTDB_id=540204 JWZ98_RS11190 WP_205454307.1 2387094..2387495(+) (ssb) [Methylomonas sp. EFPC1]
ATGCTCAATAAAGTCCAATTGATTGGCCGCCTGGGCGGTGATCCGGACGTGCGCTACCTGCCGGACGGCACGGCTACAGC
CACTATCAACCTGGCGACCACCCGGCGCTGGAAAGACCGCAACACCCAAGAACGCAAGGAAGAAACCGAGTGGCACCGCG
TGGTGTTCTTCAGCGGCCTGGCCGATATCGCCAAACAATATCTGGCAAAAGGCGCGCAAATCTACGTCGAAGGCCGTTTG
AAGACCCGCAAATGGCAAGGCCACGACAACCAGGAGCGCTACACCACCGAGATTATCGCCAACGATATGAAAATGCTGTC
CGGCAAAAAAGACAGCCCGGCGCAAAACCCTAACATCCCGCCGACTGCGGCGGATGATTTTGACGATGAAATTCCCTTTT
AA
ATGCTCAATAAAGTCCAATTGATTGGCCGCCTGGGCGGTGATCCGGACGTGCGCTACCTGCCGGACGGCACGGCTACAGC
CACTATCAACCTGGCGACCACCCGGCGCTGGAAAGACCGCAACACCCAAGAACGCAAGGAAGAAACCGAGTGGCACCGCG
TGGTGTTCTTCAGCGGCCTGGCCGATATCGCCAAACAATATCTGGCAAAAGGCGCGCAAATCTACGTCGAAGGCCGTTTG
AAGACCCGCAAATGGCAAGGCCACGACAACCAGGAGCGCTACACCACCGAGATTATCGCCAACGATATGAAAATGCTGTC
CGGCAAAAAAGACAGCCCGGCGCAAAACCCTAACATCCCGCCGACTGCGGCGGATGATTTTGACGATGAAATTCCCTTTT
AA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
40.782 |
100 |
0.549 |
| ssb | Vibrio cholerae strain A1552 |
49.606 |
95.489 |
0.474 |
| ssb | Neisseria meningitidis MC58 |
51.724 |
87.218 |
0.451 |
| ssb | Neisseria gonorrhoeae MS11 |
51.724 |
87.218 |
0.451 |