Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JQX68_RS16160 Genome accession   NZ_CP070483
Coordinates   3168010..3168150 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. LJBS06     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3163010..3173150
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQX68_RS16135 (JQX68_16135) - 3163323..3163703 (-) 381 WP_069150216.1 hotdog fold thioesterase -
  JQX68_RS16140 (JQX68_16140) comA 3163722..3164366 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JQX68_RS16145 (JQX68_16145) comP 3164447..3166756 (-) 2310 WP_205440345.1 two-component system sensor histidine kinase ComP Regulator
  JQX68_RS16150 (JQX68_16150) comX 3166771..3166938 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  JQX68_RS16155 (JQX68_16155) comQ 3166926..3167825 (-) 900 WP_103750156.1 ComX modifying isoprenyl transferase ComQ Regulator
  JQX68_RS16160 (JQX68_16160) degQ 3168010..3168150 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JQX68_RS16165 (JQX68_16165) - 3168372..3168497 (+) 126 WP_128422565.1 hypothetical protein -
  JQX68_RS16170 (JQX68_16170) - 3168612..3168980 (+) 369 WP_014665193.1 hypothetical protein -
  JQX68_RS16175 (JQX68_16175) pdeH 3168956..3170185 (-) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  JQX68_RS16180 (JQX68_16180) - 3170321..3171793 (-) 1473 WP_014665195.1 nicotinate phosphoribosyltransferase -
  JQX68_RS16185 (JQX68_16185) - 3171809..3172360 (-) 552 WP_014665196.1 isochorismatase family cysteine hydrolase -
  JQX68_RS16190 (JQX68_16190) - 3172457..3172855 (-) 399 WP_103030928.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=540039 JQX68_RS16160 WP_003220708.1 3168010..3168150(-) (degQ) [Bacillus sp. LJBS06]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=540039 JQX68_RS16160 WP_003220708.1 3168010..3168150(-) (degQ) [Bacillus sp. LJBS06]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1