Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JT366_RS16870 Genome accession   NZ_CP070367
Coordinates   3558402..3558878 (-) Length   158 a.a.
NCBI ID   WP_205396482.1    Uniprot ID   -
Organism   Sphingomonas paucimobilis strain ZJSH1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3525553..3576028 3558402..3558878 within 0


Gene organization within MGE regions


Location: 3525553..3576028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JT366_RS16720 (JT366_16720) - 3525553..3527376 (+) 1824 WP_007405800.1 UvrD-helicase domain-containing protein -
  JT366_RS16725 (JT366_16725) - 3527576..3529393 (-) 1818 WP_007405833.1 site-specific integrase -
  JT366_RS16730 (JT366_16730) - 3529889..3530320 (-) 432 WP_205396457.1 hypothetical protein -
  JT366_RS16735 (JT366_16735) - 3530317..3530904 (-) 588 WP_205396458.1 glycoside hydrolase family 19 protein -
  JT366_RS16740 (JT366_16740) - 3531003..3531338 (-) 336 WP_205396459.1 hypothetical protein -
  JT366_RS16745 (JT366_16745) - 3531335..3531823 (-) 489 WP_205396460.1 hypothetical protein -
  JT366_RS16750 (JT366_16750) - 3531884..3533281 (-) 1398 WP_205396461.1 hypothetical protein -
  JT366_RS16755 (JT366_16755) - 3533286..3538382 (-) 5097 WP_205396462.1 hypothetical protein -
  JT366_RS16760 (JT366_16760) - 3539019..3539450 (-) 432 WP_205396463.1 DUF6950 family protein -
  JT366_RS16765 (JT366_16765) - 3539447..3540088 (-) 642 WP_205396464.1 hypothetical protein -
  JT366_RS16770 (JT366_16770) - 3540085..3540681 (-) 597 WP_205396465.1 hypothetical protein -
  JT366_RS16775 (JT366_16775) - 3540678..3544157 (-) 3480 WP_205396466.1 phage tail tape measure protein -
  JT366_RS19400 (JT366_16780) - 3544171..3544452 (-) 282 WP_205396717.1 phage tail assembly chaperone -
  JT366_RS16785 (JT366_16785) - 3544482..3544841 (-) 360 WP_205396467.1 hypothetical protein -
  JT366_RS16790 (JT366_16790) - 3544844..3545272 (-) 429 WP_205396468.1 phage tail tube protein -
  JT366_RS16795 (JT366_16795) - 3545297..3545488 (-) 192 WP_205396469.1 hypothetical protein -
  JT366_RS16800 (JT366_16800) gp17 3545493..3545897 (-) 405 WP_205396470.1 tail completion protein gp17 -
  JT366_RS16805 (JT366_16805) - 3545903..3546316 (-) 414 WP_205396471.1 HK97 gp10 family phage protein -
  JT366_RS16810 (JT366_16810) - 3546313..3546648 (-) 336 WP_205396472.1 phage head closure protein -
  JT366_RS16815 (JT366_16815) - 3546648..3547193 (-) 546 WP_205396473.1 head-tail connector protein -
  JT366_RS16820 (JT366_16820) - 3547209..3547862 (-) 654 WP_205396474.1 hypothetical protein -
  JT366_RS16825 (JT366_16825) - 3547875..3548324 (-) 450 WP_205396475.1 hypothetical protein -
  JT366_RS16830 (JT366_16830) - 3548394..3549698 (-) 1305 WP_205396476.1 phage major capsid protein -
  JT366_RS16835 (JT366_16835) - 3549788..3550660 (-) 873 WP_205396477.1 S49 family peptidase -
  JT366_RS16840 (JT366_16840) - 3550662..3551855 (-) 1194 WP_205396478.1 phage portal protein -
  JT366_RS16845 (JT366_16845) - 3551918..3553669 (-) 1752 WP_240193716.1 terminase TerL endonuclease subunit -
  JT366_RS16850 (JT366_16850) - 3553683..3554150 (-) 468 WP_240193717.1 hypothetical protein -
  JT366_RS16855 (JT366_16855) - 3554229..3554585 (-) 357 WP_205396480.1 HNH endonuclease -
  JT366_RS16860 (JT366_16860) - 3554749..3555285 (-) 537 WP_240193718.1 DUF6362 family protein -
  JT366_RS16865 (JT366_16865) - 3555479..3558322 (-) 2844 WP_205396481.1 phage/plasmid primase, P4 family -
  JT366_RS16870 (JT366_16870) ssb 3558402..3558878 (-) 477 WP_205396482.1 single-stranded DNA-binding protein Machinery gene
  JT366_RS16875 (JT366_16875) - 3558875..3559636 (-) 762 WP_205396483.1 Rha family transcriptional regulator -
  JT366_RS16880 (JT366_16880) - 3559815..3560519 (-) 705 WP_205396484.1 hypothetical protein -
  JT366_RS16885 (JT366_16885) dnaN 3560554..3561666 (-) 1113 WP_205396485.1 DNA polymerase III subunit beta -
  JT366_RS16890 (JT366_16890) - 3561663..3562223 (-) 561 WP_205396486.1 hypothetical protein -
  JT366_RS16895 (JT366_16895) - 3562223..3562495 (-) 273 WP_205396487.1 hypothetical protein -
  JT366_RS16900 (JT366_16900) - 3562495..3562974 (-) 480 WP_205396488.1 hypothetical protein -
  JT366_RS16905 (JT366_16905) - 3562971..3563663 (-) 693 WP_205396489.1 hypothetical protein -
  JT366_RS16910 (JT366_16910) - 3563660..3563935 (-) 276 WP_205396490.1 helix-turn-helix transcriptional regulator -
  JT366_RS16915 (JT366_16915) - 3563964..3564743 (+) 780 WP_205396491.1 XRE family transcriptional regulator -
  JT366_RS16920 (JT366_16920) - 3565318..3565560 (+) 243 WP_205396492.1 hypothetical protein -
  JT366_RS16925 (JT366_16925) - 3565560..3566039 (+) 480 WP_205396493.1 hypothetical protein -
  JT366_RS16930 (JT366_16930) - 3566036..3566590 (+) 555 WP_205396494.1 hypothetical protein -
  JT366_RS16935 (JT366_16935) - 3566593..3566994 (+) 402 WP_205396495.1 hypothetical protein -
  JT366_RS16940 (JT366_16940) - 3566997..3568871 (+) 1875 WP_205396496.1 ParB/RepB/Spo0J family partition protein -
  JT366_RS16945 (JT366_16945) - 3568873..3569730 (+) 858 WP_205396497.1 hypothetical protein -
  JT366_RS16950 (JT366_16950) - 3569727..3569906 (+) 180 WP_205396498.1 hypothetical protein -
  JT366_RS16955 (JT366_16955) - 3569903..3570379 (+) 477 WP_205396499.1 hypothetical protein -
  JT366_RS16960 (JT366_16960) - 3570376..3570630 (+) 255 WP_205396500.1 hypothetical protein -
  JT366_RS16965 (JT366_16965) - 3570636..3571727 (+) 1092 WP_240193719.1 tyrosine-type recombinase/integrase -
  JT366_RS16975 (JT366_16975) recJ 3571870..3573624 (-) 1755 WP_007405848.1 single-stranded-DNA-specific exonuclease RecJ -
  JT366_RS16980 (JT366_16980) - 3573715..3574401 (-) 687 WP_007405820.1 prolyl hydroxylase family protein -
  JT366_RS16985 (JT366_16985) - 3574466..3575356 (-) 891 WP_042469012.1 RcnB family protein -
  JT366_RS16990 (JT366_16990) - 3575471..3576028 (-) 558 WP_007405759.1 (2Fe-2S)-binding protein -

Sequence


Protein


Download         Length: 158 a.a.        Molecular weight: 16785.49 Da        Isoelectric Point: 7.0206

>NTDB_id=539499 JT366_RS16870 WP_205396482.1 3558402..3558878(-) (ssb) [Sphingomonas paucimobilis strain ZJSH1]
MSSVNKVILVGNLGRDPEVRSFQNGGKVAELRIATSETWKDRNSGERKEKVEWHTVKIFNEGLVGVAERFLRKGSKVYVE
GALTTRKWQDQQGNDRYSTEVTLQGFSAKLVLLDGADGGQRGSRSTGGTQGGASSGAGGGGGFGGGGFTDDLDDDVPF

Nucleotide


Download         Length: 477 bp        

>NTDB_id=539499 JT366_RS16870 WP_205396482.1 3558402..3558878(-) (ssb) [Sphingomonas paucimobilis strain ZJSH1]
ATGAGCAGCGTCAACAAGGTCATCCTGGTCGGCAATCTCGGCCGCGATCCCGAAGTCCGGTCTTTTCAGAACGGCGGCAA
GGTGGCCGAGCTGCGCATTGCGACGTCGGAGACGTGGAAGGATCGCAACAGCGGCGAGCGCAAGGAAAAGGTCGAGTGGC
ACACGGTCAAGATCTTCAACGAGGGACTGGTCGGCGTGGCCGAGCGGTTCCTGCGCAAGGGATCGAAGGTCTATGTCGAG
GGCGCGTTGACCACTCGCAAGTGGCAGGACCAGCAGGGCAATGACCGCTATTCGACCGAGGTGACGCTTCAGGGTTTCTC
CGCGAAGCTGGTCCTGCTCGACGGGGCCGATGGCGGCCAGCGTGGCAGCCGGTCGACCGGCGGGACGCAGGGCGGCGCGT
CTTCGGGCGCAGGCGGTGGTGGTGGTTTCGGTGGCGGCGGCTTCACCGACGACCTGGACGACGACGTCCCCTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

45.946

100

0.538

  ssb Vibrio cholerae strain A1552

46.552

100

0.513

  ssb Neisseria gonorrhoeae MS11

33.52

100

0.38

  ssb Neisseria meningitidis MC58

32.571

100

0.361