Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JWB57_RS00340 | Genome accession | NZ_CP070358 |
| Coordinates | 62666..63019 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075-VUB-itrA::ISAba13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 60300..94438 | 62666..63019 | within | 0 |
Gene organization within MGE regions
Location: 60300..94438
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JWB57_RS00320 (JWB57_02565) | - | 60300..61367 (+) | 1068 | WP_000107855.1 | site-specific integrase | - |
| JWB57_RS00325 (JWB57_02570) | - | 61395..61691 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| JWB57_RS00330 (JWB57_02575) | - | 61688..61909 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| JWB57_RS00335 (JWB57_02580) | - | 61919..62656 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| JWB57_RS00340 (JWB57_02585) | ssb | 62666..63019 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| JWB57_RS00345 (JWB57_02590) | - | 63007..63324 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| JWB57_RS00350 (JWB57_02595) | - | 63317..63487 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| JWB57_RS00355 (JWB57_02600) | - | 63477..64028 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| JWB57_RS00360 (JWB57_02605) | - | 64094..64426 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| JWB57_RS00365 (JWB57_02610) | - | 64423..67161 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| JWB57_RS00370 (JWB57_02615) | - | 67255..67446 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| JWB57_RS00375 (JWB57_02620) | - | 67539..67880 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| JWB57_RS00380 (JWB57_02625) | - | 67925..68140 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| JWB57_RS00385 (JWB57_02630) | - | 68265..69080 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| JWB57_RS00390 (JWB57_02635) | - | 69188..69382 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| JWB57_RS00395 (JWB57_02640) | - | 69692..70570 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| JWB57_RS00400 (JWB57_02645) | - | 70570..70851 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| JWB57_RS00405 (JWB57_02650) | - | 71167..71367 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| JWB57_RS00410 (JWB57_02655) | - | 71364..71603 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| JWB57_RS00415 (JWB57_02660) | - | 71733..73046 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| JWB57_RS00420 (JWB57_02665) | - | 73047..73487 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| JWB57_RS00425 (JWB57_02670) | - | 73493..75943 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| JWB57_RS00435 (JWB57_02680) | - | 77218..78039 (+) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| JWB57_RS00440 (JWB57_02685) | - | 78144..78806 (-) | 663 | Protein_76 | ATP-binding protein | - |
| JWB57_RS20270 | - | 78810..78896 (-) | 87 | Protein_77 | GpE family phage tail protein | - |
| JWB57_RS00445 (JWB57_02695) | - | 78899..79240 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| JWB57_RS00450 (JWB57_02700) | - | 79307..79825 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| JWB57_RS00455 (JWB57_02705) | - | 79838..81013 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| JWB57_RS00460 (JWB57_02710) | - | 81163..83115 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| JWB57_RS00465 (JWB57_02715) | - | 83127..83732 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| JWB57_RS00470 (JWB57_02720) | - | 83732..84634 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| JWB57_RS00475 (JWB57_02725) | - | 84631..84978 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| JWB57_RS00480 (JWB57_02730) | - | 84975..85607 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| JWB57_RS00485 (JWB57_02735) | - | 85680..86129 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| JWB57_RS00490 (JWB57_02740) | - | 86126..86653 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| JWB57_RS00495 (JWB57_02745) | - | 86650..87480 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| JWB57_RS00500 (JWB57_02750) | - | 87477..87746 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| JWB57_RS00505 (JWB57_02755) | - | 87743..88093 (-) | 351 | WP_001114936.1 | putative holin | - |
| JWB57_RS00510 (JWB57_02760) | - | 88102..88311 (-) | 210 | WP_000659474.1 | tail protein X | - |
| JWB57_RS00515 (JWB57_02765) | - | 88312..88764 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| JWB57_RS00520 (JWB57_02770) | gpM | 88868..89614 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| JWB57_RS00525 (JWB57_02775) | - | 89625..90614 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| JWB57_RS00530 (JWB57_02780) | - | 90667..91494 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| JWB57_RS00535 (JWB57_02785) | - | 91632..93440 (+) | 1809 | WP_000289874.1 | terminase family protein | - |
| JWB57_RS00540 (JWB57_02790) | - | 93440..94438 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=539381 JWB57_RS00340 WP_002014678.1 62666..63019(-) (ssb) [Acinetobacter baumannii strain AB5075-VUB-itrA::ISAba13]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=539381 JWB57_RS00340 WP_002014678.1 62666..63019(-) (ssb) [Acinetobacter baumannii strain AB5075-VUB-itrA::ISAba13]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |