Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I6K56_RS02425 Genome accession   NZ_CP069821
Coordinates   507320..507844 (+) Length   174 a.a.
NCBI ID   WP_004151744.1    Uniprot ID   -
Organism   Klebsiella pneumoniae strain FDAARGOS_1326     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 483754..539632 507320..507844 within 0


Gene organization within MGE regions


Location: 483754..539632
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6K56_RS02310 (I6K56_02310) malK 483754..484863 (+) 1110 WP_002884743.1 maltose/maltodextrin ABC transporter ATP-binding protein MalK -
  I6K56_RS02315 (I6K56_02315) - 484947..486236 (+) 1290 WP_002884747.1 maltoporin -
  I6K56_RS02320 (I6K56_02320) malM 486351..487274 (+) 924 WP_004151749.1 maltose operon protein MalM -
  I6K56_RS02325 (I6K56_02325) ubiC 487462..487959 (+) 498 WP_002884807.1 chorismate lyase -
  I6K56_RS02330 (I6K56_02330) ubiA 487972..488838 (+) 867 WP_032433759.1 4-hydroxybenzoate octaprenyltransferase -
  I6K56_RS02335 (I6K56_02335) plsB 488887..491310 (-) 2424 WP_004178269.1 glycerol-3-phosphate 1-O-acyltransferase PlsB -
  I6K56_RS02340 (I6K56_02340) - 491439..491807 (+) 369 WP_002884819.1 diacylglycerol kinase -
  I6K56_RS02345 (I6K56_02345) lexA 491930..492538 (+) 609 WP_002884822.1 transcriptional repressor LexA -
  I6K56_RS02350 (I6K56_02350) dinF 492608..493924 (+) 1317 WP_004151748.1 MATE family efflux transporter DinF -
  I6K56_RS02355 (I6K56_02355) - 493944..494093 (-) 150 WP_004219133.1 hypothetical protein -
  I6K56_RS02360 (I6K56_02360) - 494159..494368 (+) 210 WP_004151747.1 CsbD family protein -
  I6K56_RS02365 (I6K56_02365) zur 494464..494979 (-) 516 WP_002884931.1 zinc uptake transcriptional repressor Zur -
  I6K56_RS02370 (I6K56_02370) - 495229..495717 (+) 489 WP_002884935.1 cupin domain-containing protein -
  I6K56_RS02375 (I6K56_02375) dusA 495818..496816 (+) 999 WP_025368550.1 tRNA dihydrouridine(20/20a) synthase DusA -
  I6K56_RS02380 (I6K56_02380) pspG 496956..497198 (+) 243 WP_009484997.1 envelope stress response protein PspG -
  I6K56_RS02385 (I6K56_02385) - 497381..498364 (-) 984 WP_002884941.1 quinone oxidoreductase -
  I6K56_RS02390 (I6K56_02390) dnaB 498534..499949 (+) 1416 WP_002884942.1 replicative DNA helicase -
  I6K56_RS02395 (I6K56_02395) alr 499981..501060 (+) 1080 WP_002884943.1 alanine racemase -
  I6K56_RS02400 (I6K56_02400) tyrB 501237..502430 (+) 1194 WP_002884946.1 aromatic amino acid transaminase -
  I6K56_RS02405 (I6K56_02405) aphA 502622..503335 (+) 714 WP_004151745.1 acid phosphatase AphA -
  I6K56_RS02410 (I6K56_02410) - 503466..503882 (+) 417 WP_002884951.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  I6K56_RS02415 (I6K56_02415) - 503886..504242 (+) 357 WP_002884953.1 MmcQ/YjbR family DNA-binding protein -
  I6K56_RS02420 (I6K56_02420) uvrA 504243..507068 (-) 2826 WP_004146620.1 excinuclease ABC subunit UvrA -
  I6K56_RS02425 (I6K56_02425) ssb 507320..507844 (+) 525 WP_004151744.1 single-stranded DNA-binding protein SSB1 Machinery gene
  I6K56_RS02430 (I6K56_02430) - 507969..509549 (-) 1581 WP_032433760.1 lytic transglycosylase F -
  I6K56_RS02435 (I6K56_02435) - 510088..511056 (-) 969 WP_076026135.1 IS5-like element IS903B family transposase -
  I6K56_RS02440 (I6K56_02440) - 511380..511709 (+) 330 WP_000493286.1 type II toxin-antitoxin system RelE/ParE family toxin -
  I6K56_RS02445 (I6K56_02445) - 511690..511971 (+) 282 WP_000780222.1 helix-turn-helix domain-containing protein -
  I6K56_RS02450 (I6K56_02450) - 512118..512594 (-) 477 WP_194164765.1 DUF4113 domain-containing protein -
  I6K56_RS02455 (I6K56_02455) - 512684..514198 (-) 1515 Protein_462 Tn3-like element TnAs1 family transposase -
  I6K56_RS02460 (I6K56_02460) - 514264..514968 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  I6K56_RS27060 - 515084..515305 (+) 222 Protein_464 resolvase -
  I6K56_RS02465 (I6K56_02465) - 515491..517749 (+) 2259 WP_004177845.1 TonB-dependent siderophore receptor -
  I6K56_RS02470 (I6K56_02470) - 518013..518381 (-) 369 WP_032433761.1 helix-turn-helix transcriptional regulator -
  I6K56_RS02475 (I6K56_02475) - 518415..520175 (-) 1761 WP_032433762.1 tannase/feruloyl esterase family alpha/beta hydrolase -
  I6K56_RS02480 (I6K56_02480) - 520549..520779 (-) 231 WP_032417717.1 potassium:proton antiporter -
  I6K56_RS02485 (I6K56_02485) bamA 520801..523224 (+) 2424 WP_032433763.1 outer membrane protein assembly factor BamA -
  I6K56_RS02490 (I6K56_02490) iraM 523776..524129 (+) 354 WP_002885039.1 anti-adapter protein IraM -
  I6K56_RS02495 (I6K56_02495) - 524168..524929 (-) 762 WP_004177841.1 inositol monophosphatase family protein -
  I6K56_RS02500 (I6K56_02500) - 524940..525953 (-) 1014 WP_002885046.1 LacI family DNA-binding transcriptional regulator -
  I6K56_RS02505 (I6K56_02505) - 525950..526720 (-) 771 WP_032433765.1 MBL fold metallo-hydrolase -
  I6K56_RS02510 (I6K56_02510) - 526884..527915 (+) 1032 WP_004177837.1 ABC transporter ATP-binding protein -
  I6K56_RS02515 (I6K56_02515) - 527945..529084 (+) 1140 WP_004177835.1 extracellular solute-binding protein -
  I6K56_RS02520 (I6K56_02520) - 529145..529978 (+) 834 WP_004177833.1 ABC transporter permease -
  I6K56_RS02525 (I6K56_02525) - 529975..530832 (+) 858 WP_020802409.1 ABC transporter permease -
  I6K56_RS02530 (I6K56_02530) - 530879..531160 (-) 282 WP_002885064.1 YjcB family protein -
  I6K56_RS02535 (I6K56_02535) - 531667..533271 (+) 1605 WP_023283136.1 EAL domain-containing protein -
  I6K56_RS02540 (I6K56_02540) soxS 533256..533585 (-) 330 WP_004151738.1 superoxide response transcriptional regulator SoxS -
  I6K56_RS02545 (I6K56_02545) soxR 533670..534128 (+) 459 WP_002885077.1 redox-sensitive transcriptional activator SoxR -
  I6K56_RS02550 (I6K56_02550) - 534388..535056 (+) 669 WP_032433766.1 glutathione S-transferase family protein -
  I6K56_RS02555 (I6K56_02555) - 535445..536794 (+) 1350 WP_002885079.1 NCS2 family permease -
  I6K56_RS02560 (I6K56_02560) - 536942..538588 (+) 1647 WP_002885082.1 Na+/H+ antiporter -
  I6K56_RS02565 (I6K56_02565) - 538751..539632 (-) 882 WP_004177821.1 LysR family transcriptional regulator -

Sequence


Protein


Download         Length: 174 a.a.        Molecular weight: 18711.70 Da        Isoelectric Point: 5.2358

>NTDB_id=536917 I6K56_RS02425 WP_004151744.1 507320..507844(+) (ssb) [Klebsiella pneumoniae strain FDAARGOS_1326]
MASRGVNKVILVGNLGQDPEVRYMPSGGAVANFTLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGQLRTRKWTDQSGQDKYTTEVVVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQAPAAP
SNEPPMDFDDDIPF

Nucleotide


Download         Length: 525 bp        

>NTDB_id=536917 I6K56_RS02425 WP_004151744.1 507320..507844(+) (ssb) [Klebsiella pneumoniae strain FDAARGOS_1326]
ATGGCCAGCAGAGGCGTAAACAAGGTGATTCTCGTCGGTAATCTGGGGCAGGACCCGGAAGTACGCTACATGCCAAGTGG
CGGCGCTGTCGCCAACTTCACGCTGGCAACTTCCGAATCCTGGCGTGACAAGCAGACCGGCGAAATGAAAGAGCAGACCG
AGTGGCACCGCGTTGTGCTGTTCGGCAAACTGGCGGAAGTCGCTGGTGAGTATCTGCGTAAAGGCTCTCAGGTGTACATT
GAAGGCCAGCTGCGTACCCGCAAGTGGACCGATCAATCCGGTCAGGACAAATACACCACCGAAGTGGTGGTGAACGTGGG
CGGCACCATGCAGATGCTGGGCGGCCGTCAGGGCGGCGGCGCACCGGCAGGCGGCGGCCAGCAGCAGGGCGGTTGGGGTC
AGCCGCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGCGCAGTCCCGTCCGCAGCAGCAGGCCCCGGCAGCGCCT
TCCAACGAACCGCCGATGGACTTCGACGACGACATCCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

75

100

0.776

  ssb Glaesserella parasuis strain SC1401

59.239

100

0.626

  ssb Neisseria meningitidis MC58

48.603

100

0.5

  ssb Neisseria gonorrhoeae MS11

48.603

100

0.5