Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JQU52_RS05390 Genome accession   NZ_CP069798
Coordinates   1062871..1063344 (+) Length   157 a.a.
NCBI ID   WP_230340111.1    Uniprot ID   A0A892ZIG0
Organism   Paralysiella testudinis strain 26B     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1062617..1127893 1062871..1063344 within 0


Gene organization within MGE regions


Location: 1062617..1127893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQU52_RS05390 (JQU52_05420) ssb 1062871..1063344 (+) 474 WP_230340111.1 single-stranded DNA-binding protein Machinery gene
  JQU52_RS05395 (JQU52_05425) - 1063429..1064196 (+) 768 WP_230340112.1 hypothetical protein -
  JQU52_RS05400 (JQU52_05430) - 1064193..1064984 (+) 792 WP_230340113.1 lytic transglycosylase domain-containing protein -
  JQU52_RS05405 (JQU52_05435) - 1065194..1065505 (+) 312 WP_230340114.1 TrbC/VirB2 family protein -
  JQU52_RS05410 - 1065515..1065949 (+) 435 WP_230340115.1 VirB3 family type IV secretion system protein -
  JQU52_RS05415 (JQU52_05440) - 1065993..1068272 (+) 2280 WP_407947614.1 conjugal transfer protein -
  JQU52_RS05420 (JQU52_05445) - 1068429..1068644 (-) 216 WP_230340117.1 hypothetical protein -
  JQU52_RS05425 (JQU52_05450) - 1068835..1069491 (+) 657 WP_230340118.1 type IV secretion system protein -
  JQU52_RS05430 (JQU52_05455) - 1069554..1070495 (+) 942 WP_230340119.1 type IV secretion system protein -
  JQU52_RS05435 (JQU52_05460) - 1070521..1070688 (+) 168 WP_230340120.1 hypothetical protein -
  JQU52_RS05440 (JQU52_05465) - 1070819..1071532 (+) 714 WP_230340121.1 Fic family protein -
  JQU52_RS05445 (JQU52_05470) - 1072463..1073395 (+) 933 WP_230340122.1 Bro-N domain-containing protein -
  JQU52_RS05450 (JQU52_05475) - 1073463..1073726 (-) 264 WP_230340123.1 hypothetical protein -
  JQU52_RS05455 (JQU52_05480) - 1073725..1073850 (+) 126 WP_230340124.1 lipoprotein -
  JQU52_RS05460 (JQU52_05485) - 1073847..1074557 (+) 711 WP_230340125.1 virB8 family protein -
  JQU52_RS05465 (JQU52_05490) virB9 1074572..1075384 (+) 813 WP_230340126.1 P-type conjugative transfer protein VirB9 -
  JQU52_RS05470 (JQU52_05495) virB10 1075396..1076661 (+) 1266 WP_230340127.1 type IV secretion system protein VirB10 -
  JQU52_RS05475 (JQU52_05500) - 1076734..1077864 (+) 1131 WP_230340128.1 ATPase, T2SS/T4P/T4SS family -
  JQU52_RS05480 (JQU52_05505) - 1077910..1078437 (+) 528 WP_230340129.1 hypothetical protein -
  JQU52_RS05485 (JQU52_05510) - 1078378..1079316 (-) 939 WP_230340130.1 hypothetical protein -
  JQU52_RS05490 (JQU52_05515) - 1079366..1079797 (+) 432 WP_230340131.1 fibroblast growth factor -
  JQU52_RS05495 - 1079926..1080705 (+) 780 WP_230340132.1 hypothetical protein -
  JQU52_RS05500 (JQU52_05525) - 1080815..1081087 (+) 273 WP_230340133.1 hypothetical protein -
  JQU52_RS05505 (JQU52_05530) - 1081494..1081664 (+) 171 WP_230340134.1 hypothetical protein -
  JQU52_RS05510 (JQU52_05535) - 1081737..1084670 (+) 2934 WP_230340135.1 S8 family serine peptidase -
  JQU52_RS05515 (JQU52_05540) - 1084949..1085953 (+) 1005 WP_230340136.1 OmpA family protein -
  JQU52_RS05520 (JQU52_05545) - 1085968..1087947 (+) 1980 WP_379061262.1 YadA-like family protein -
  JQU52_RS05525 (JQU52_05550) - 1088076..1088222 (+) 147 WP_230340138.1 hypothetical protein -
  JQU52_RS05530 (JQU52_05555) - 1088176..1088568 (+) 393 WP_230340139.1 hypothetical protein -
  JQU52_RS05535 (JQU52_05560) - 1088645..1089139 (+) 495 WP_230340140.1 thermonuclease family protein -
  JQU52_RS05540 (JQU52_05565) - 1089174..1089371 (+) 198 WP_230340141.1 hypothetical protein -
  JQU52_RS14850 (JQU52_05570) - 1089418..1089636 (+) 219 WP_379061289.1 type II toxin-antitoxin system RelE/ParE family toxin -
  JQU52_RS05545 (JQU52_05575) - 1089739..1090074 (+) 336 WP_230340142.1 hypothetical protein -
  JQU52_RS05550 (JQU52_05580) - 1090104..1090457 (-) 354 WP_230340143.1 hypothetical protein -
  JQU52_RS05555 (JQU52_05585) - 1090512..1090940 (+) 429 WP_230340144.1 single-stranded DNA-binding protein -
  JQU52_RS05560 (JQU52_05590) vapB 1091055..1091282 (+) 228 WP_230340145.1 type II toxin-antitoxin system VapB family antitoxin -
  JQU52_RS05565 (JQU52_05595) vapC 1091294..1091689 (+) 396 WP_328301398.1 tRNA(fMet)-specific endonuclease VapC -
  JQU52_RS05570 (JQU52_05600) - 1091916..1092191 (+) 276 WP_230340147.1 DUF1778 domain-containing protein -
  JQU52_RS05575 (JQU52_05605) - 1092194..1092700 (+) 507 WP_230340148.1 GNAT family N-acetyltransferase -
  JQU52_RS05580 (JQU52_05610) - 1092761..1094761 (+) 2001 WP_230340149.1 type IV secretory system conjugative DNA transfer family protein -
  JQU52_RS05585 (JQU52_05615) - 1094856..1095377 (+) 522 WP_230340150.1 hypothetical protein -
  JQU52_RS05590 (JQU52_05620) - 1095407..1095670 (-) 264 WP_230340151.1 Txe/YoeB family addiction module toxin -
  JQU52_RS05595 (JQU52_05625) - 1095667..1095921 (-) 255 WP_230340152.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
  JQU52_RS05600 (JQU52_05630) - 1096044..1096802 (+) 759 WP_230340153.1 hypothetical protein -
  JQU52_RS05605 (JQU52_05635) - 1096805..1097194 (+) 390 WP_230340154.1 hypothetical protein -
  JQU52_RS05610 (JQU52_05640) - 1097241..1097846 (+) 606 WP_230340155.1 hypothetical protein -
  JQU52_RS05615 (JQU52_05645) - 1097939..1102078 (+) 4140 WP_230340156.1 LPD7 domain-containing protein -
  JQU52_RS05620 (JQU52_05650) - 1102236..1104014 (+) 1779 WP_230340157.1 hypothetical protein -
  JQU52_RS05625 (JQU52_05655) - 1104135..1104671 (+) 537 WP_230340158.1 plasmid mobilization protein -
  JQU52_RS05630 (JQU52_05660) - 1104682..1105755 (+) 1074 WP_230340159.1 relaxase/mobilization nuclease domain-containing protein -
  JQU52_RS05635 (JQU52_05665) - 1105825..1106262 (+) 438 WP_230340160.1 DUF5131 family protein -
  JQU52_RS05640 (JQU52_05670) - 1106156..1106437 (+) 282 WP_230340161.1 DUF1778 domain-containing protein -
  JQU52_RS05645 (JQU52_05675) - 1106428..1106964 (+) 537 WP_230340162.1 GNAT family N-acetyltransferase -
  JQU52_RS05650 (JQU52_05680) - 1107388..1107807 (-) 420 WP_230340163.1 hypothetical protein -
  JQU52_RS05655 (JQU52_05685) - 1107993..1108394 (-) 402 WP_230340164.1 phosphoglycerate kinase -
  JQU52_RS05660 (JQU52_05690) - 1109012..1109533 (+) 522 WP_230340165.1 hypothetical protein -
  JQU52_RS05665 (JQU52_05695) - 1109613..1110026 (+) 414 WP_230340166.1 DUF4878 domain-containing protein -
  JQU52_RS05670 (JQU52_05700) - 1110080..1110709 (+) 630 WP_230340167.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
  JQU52_RS05675 (JQU52_05705) - 1110746..1111165 (-) 420 WP_230340168.1 type II toxin-antitoxin system VapC family toxin -
  JQU52_RS05680 (JQU52_05710) - 1111165..1111437 (-) 273 WP_230340169.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  JQU52_RS05685 (JQU52_05715) - 1111947..1112555 (-) 609 WP_230340170.1 hypothetical protein -
  JQU52_RS05690 (JQU52_05720) - 1112746..1112991 (-) 246 WP_230340171.1 helix-turn-helix transcriptional regulator -
  JQU52_RS05695 (JQU52_05725) - 1113090..1113725 (+) 636 WP_230340172.1 helix-turn-helix domain-containing protein -
  JQU52_RS05700 (JQU52_05730) - 1114423..1114653 (+) 231 WP_230340173.1 antitoxin MazE family protein -
  JQU52_RS05705 (JQU52_05735) - 1114650..1114976 (+) 327 WP_230340174.1 type II toxin-antitoxin system PemK/MazF family toxin -
  JQU52_RS05715 (JQU52_05745) - 1115187..1115357 (+) 171 WP_230340175.1 hypothetical protein -
  JQU52_RS05720 (JQU52_05750) - 1115720..1116517 (-) 798 WP_230340176.1 hypothetical protein -
  JQU52_RS05725 (JQU52_05755) - 1116517..1116741 (-) 225 WP_230340177.1 hypothetical protein -
  JQU52_RS05730 (JQU52_05760) - 1116849..1117532 (+) 684 WP_230340178.1 S24 family peptidase -
  JQU52_RS05740 (JQU52_05770) - 1118647..1118817 (+) 171 WP_230340179.1 hypothetical protein -
  JQU52_RS05745 (JQU52_05775) - 1119178..1119786 (-) 609 WP_230340180.1 hypothetical protein -
  JQU52_RS05750 (JQU52_05780) - 1119971..1120165 (-) 195 WP_230340181.1 Cro/CI family transcriptional regulator -
  JQU52_RS05755 (JQU52_05785) - 1120270..1120917 (+) 648 WP_230340182.1 LexA family transcriptional regulator -
  JQU52_RS05760 (JQU52_05790) - 1121615..1121845 (+) 231 WP_230340173.1 antitoxin MazE family protein -
  JQU52_RS05765 (JQU52_05795) - 1121842..1122060 (+) 219 WP_230340183.1 type II toxin-antitoxin system PemK/MazF family toxin -
  JQU52_RS05775 (JQU52_05805) - 1122373..1123263 (+) 891 WP_230340184.1 hypothetical protein -
  JQU52_RS05780 (JQU52_05810) - 1123282..1123977 (+) 696 WP_230340185.1 hypothetical protein -
  JQU52_RS05785 (JQU52_05815) - 1124125..1124670 (+) 546 WP_230340186.1 TrbM/KikA/MpfK family conjugal transfer protein -
  JQU52_RS05790 (JQU52_05820) - 1124618..1125604 (+) 987 WP_230340187.1 conjugal transfer protein TraL -
  JQU52_RS05795 (JQU52_05825) - 1125582..1126016 (+) 435 WP_230340188.1 hypothetical protein -
  JQU52_RS05800 (JQU52_05830) - 1126029..1126283 (+) 255 WP_230340189.1 toxin PIN -
  JQU52_RS05805 (JQU52_05835) - 1126329..1126553 (+) 225 WP_230340190.1 hypothetical protein -
  JQU52_RS05810 (JQU52_05840) - 1126566..1126895 (+) 330 WP_230340191.1 helix-turn-helix domain-containing protein -
  JQU52_RS05815 (JQU52_05845) - 1126811..1127809 (+) 999 WP_268866638.1 site-specific integrase -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17498.77 Da        Isoelectric Point: 7.1664

>NTDB_id=536745 JQU52_RS05390 WP_230340111.1 1062871..1063344(+) (ssb) [Paralysiella testudinis strain 26B]
MTVNKVQLIGRLGRDPEVRYMPNGDAVCHFSIATEEQWKDRDGNRQTRTEWHSIVLYRKLGEIAGQYLRKGGLVYIDGRI
QSRKYTGKDGVERTAYEIIGNEMKMLGSKELGVKAANRPAEEAQPQATPSAMPPVGGQSSQRPAPVPVDDIDDDIPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=536745 JQU52_RS05390 WP_230340111.1 1062871..1063344(+) (ssb) [Paralysiella testudinis strain 26B]
ATGACTGTGAACAAAGTCCAACTTATCGGCCGCCTCGGGCGCGACCCGGAAGTACGCTATATGCCCAACGGCGATGCCGT
ATGCCATTTTTCCATCGCCACTGAAGAACAGTGGAAAGACCGTGACGGCAACCGTCAAACCCGCACCGAATGGCACAGCA
TCGTGTTGTACCGCAAGCTGGGCGAAATCGCCGGGCAATATTTGCGCAAAGGTGGTTTGGTTTACATTGACGGACGCATT
CAGAGCCGTAAATACACCGGCAAAGACGGGGTGGAACGTACTGCGTATGAAATCATCGGTAACGAAATGAAAATGCTCGG
CAGCAAGGAGCTTGGCGTGAAGGCTGCAAACCGCCCGGCTGAGGAGGCTCAACCTCAAGCTACACCGTCGGCAATGCCGC
CTGTTGGTGGTCAAAGCAGTCAGCGGCCAGCCCCCGTACCTGTGGATGATATTGACGACGACATCCCGTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Neisseria meningitidis MC58

59.77

100

0.662

  ssb Neisseria gonorrhoeae MS11

58.621

100

0.65

  ssb Vibrio cholerae strain A1552

44.767

100

0.49

  ssb Glaesserella parasuis strain SC1401

40.113

100

0.452