Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JSQ86_RS07340 Genome accession   NZ_CP069707
Coordinates   1504033..1504506 (-) Length   157 a.a.
NCBI ID   WP_032182883.1    Uniprot ID   -
Organism   Escherichia coli strain E41     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1491186..1538576 1504033..1504506 within 0


Gene organization within MGE regions


Location: 1491186..1538576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JSQ86_RS07245 (JSQ86_07245) - 1492049..1494688 (-) 2640 WP_113078622.1 DUF927 domain-containing protein -
  JSQ86_RS07250 (JSQ86_07250) - 1494685..1495068 (-) 384 WP_001075586.1 DUF5375 family protein -
  JSQ86_RS07255 (JSQ86_07255) - 1495065..1495349 (-) 285 WP_001027154.1 hypothetical protein -
  JSQ86_RS07260 (JSQ86_07260) - 1495381..1495740 (-) 360 WP_001246994.1 hypothetical protein -
  JSQ86_RS07265 (JSQ86_07265) - 1495733..1495909 (-) 177 WP_001118612.1 host cell division inhibitor Icd-like protein -
  JSQ86_RS24130 - 1496026..1496220 (+) 195 WP_000538173.1 hypothetical protein -
  JSQ86_RS07270 (JSQ86_07270) - 1496270..1496485 (-) 216 WP_000173141.1 AlpA family phage regulatory protein -
  JSQ86_RS07275 (JSQ86_07275) - 1496588..1497001 (-) 414 WP_251302284.1 hypothetical protein -
  JSQ86_RS24135 - 1497830..1498021 (-) 192 WP_251302285.1 hypothetical protein -
  JSQ86_RS07290 (JSQ86_07290) - 1498276..1499550 (-) 1275 WP_000996991.1 integrase arm-type DNA-binding domain-containing protein -
  JSQ86_RS07295 (JSQ86_07295) torI 1499823..1500023 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  JSQ86_RS07300 (JSQ86_07300) - 1500146..1500490 (-) 345 WP_001281193.1 hypothetical protein -
  JSQ86_RS07305 (JSQ86_07305) - 1500591..1500770 (-) 180 WP_032169734.1 Eag protein -
  JSQ86_RS07310 (JSQ86_07310) - 1500867..1501541 (-) 675 WP_204098168.1 DUF551 domain-containing protein -
  JSQ86_RS07315 (JSQ86_07315) - 1501538..1502134 (-) 597 WP_000151156.1 ead/Ea22-like family protein -
  JSQ86_RS07320 (JSQ86_07320) - 1502131..1502775 (-) 645 WP_204098169.1 hypothetical protein -
  JSQ86_RS07325 (JSQ86_07325) - 1502772..1502939 (-) 168 WP_001214448.1 DUF2737 family protein -
  JSQ86_RS07330 (JSQ86_07330) - 1502936..1503226 (-) 291 WP_000855561.1 DUF5405 family protein -
  JSQ86_RS07335 (JSQ86_07335) - 1503237..1503530 (-) 294 WP_001111298.1 phage anti-RecBCD protein -
  JSQ86_RS07340 (JSQ86_07340) ssb 1504033..1504506 (-) 474 WP_032182883.1 single-stranded DNA-binding protein Machinery gene
  JSQ86_RS07345 (JSQ86_07345) - 1504507..1505214 (-) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  JSQ86_RS07350 (JSQ86_07350) - 1505469..1505639 (-) 171 WP_001183771.1 hypothetical protein -
  JSQ86_RS07355 (JSQ86_07355) - 1505866..1506066 (-) 201 WP_204098170.1 antirestriction Ral family protein -
  JSQ86_RS24140 - 1506412..1506518 (-) 107 Protein_1450 antitermination protein N -
  JSQ86_RS07365 (JSQ86_07365) - 1507260..1507946 (-) 687 WP_152914768.1 S24 family peptidase -
  JSQ86_RS07370 (JSQ86_07370) - 1508055..1508285 (+) 231 WP_000391959.1 YdaS family helix-turn-helix protein -
  JSQ86_RS07375 (JSQ86_07375) - 1508402..1508683 (+) 282 WP_000536662.1 CII family transcriptional regulator -
  JSQ86_RS07380 (JSQ86_07380) - 1508718..1508879 (+) 162 WP_000166961.1 hypothetical protein -
  JSQ86_RS07385 (JSQ86_07385) - 1508866..1509687 (+) 822 WP_016063336.1 replication protein -
  JSQ86_RS07390 (JSQ86_07390) - 1509684..1511060 (+) 1377 WP_001248388.1 replicative DNA helicase -
  JSQ86_RS07395 (JSQ86_07395) - 1511133..1511339 (+) 207 WP_023351780.1 hypothetical protein -
  JSQ86_RS07400 (JSQ86_07400) - 1511357..1511668 (+) 312 WP_204098172.1 hypothetical protein -
  JSQ86_RS07405 (JSQ86_07405) - 1511671..1512081 (+) 411 WP_204098173.1 recombination protein NinB -
  JSQ86_RS07410 (JSQ86_07410) - 1512078..1512254 (+) 177 WP_021511843.1 NinE family protein -
  JSQ86_RS07415 (JSQ86_07415) - 1512257..1512658 (+) 402 WP_204098174.1 hypothetical protein -
  JSQ86_RS07420 (JSQ86_07420) - 1512618..1512827 (+) 210 WP_204098175.1 protein NinF -
  JSQ86_RS07425 (JSQ86_07425) - 1512820..1513089 (+) 270 WP_016242496.1 hypothetical protein -
  JSQ86_RS07430 (JSQ86_07430) - 1513089..1513379 (+) 291 Protein_1464 DUF1364 domain-containing protein -
  JSQ86_RS07435 (JSQ86_07435) - 1513376..1513738 (+) 363 WP_001008199.1 RusA family crossover junction endodeoxyribonuclease -
  JSQ86_RS07440 (JSQ86_07440) - 1513735..1513923 (+) 189 WP_000994516.1 protein ninH -
  JSQ86_RS07445 (JSQ86_07445) - 1513920..1514543 (+) 624 WP_001235461.1 antitermination protein -
  JSQ86_RS07450 (JSQ86_07450) - 1514976..1515299 (+) 324 WP_015966862.1 phage holin, lambda family -
  JSQ86_RS07455 (JSQ86_07455) - 1515283..1515759 (+) 477 WP_204098176.1 glycoside hydrolase family protein -
  JSQ86_RS07460 (JSQ86_07460) - 1515756..1516223 (+) 468 WP_204098177.1 lysis protein -
  JSQ86_RS07465 (JSQ86_07465) - 1516211..1516363 (+) 153 WP_001139680.1 hypothetical protein -
  JSQ86_RS07475 (JSQ86_07475) - 1516566..1517051 (+) 486 WP_050867239.1 GIY-YIG nuclease family protein -
  JSQ86_RS07480 (JSQ86_07480) - 1517230..1517610 (+) 381 WP_000999686.1 Gp49 family protein -
  JSQ86_RS07485 (JSQ86_07485) - 1517714..1517956 (+) 243 WP_000807780.1 DUF2560 family protein -
  JSQ86_RS07490 (JSQ86_07490) - 1517959..1518396 (+) 438 WP_025765985.1 hypothetical protein -
  JSQ86_RS07495 (JSQ86_07495) - 1518396..1519856 (+) 1461 WP_001543879.1 hypothetical protein -
  JSQ86_RS07500 (JSQ86_07500) - 1519856..1522024 (+) 2169 WP_001543878.1 portal protein -
  JSQ86_RS07505 (JSQ86_07505) - 1522038..1522949 (+) 912 WP_021549561.1 scaffolding protein -
  JSQ86_RS07510 (JSQ86_07510) - 1522949..1524244 (+) 1296 WP_001196946.1 P22 phage major capsid protein family protein -
  JSQ86_RS07515 (JSQ86_07515) - 1524289..1524543 (+) 255 WP_062870091.1 hypothetical protein -
  JSQ86_RS07520 (JSQ86_07520) - 1524521..1525021 (+) 501 WP_001054834.1 packaged DNA stabilization gp4 family protein -
  JSQ86_RS07525 (JSQ86_07525) - 1525021..1526439 (+) 1419 WP_204098178.1 packaged DNA stabilization protein gp10 -
  JSQ86_RS07530 (JSQ86_07530) - 1526443..1527081 (+) 639 WP_204098179.1 phage tail protein -
  JSQ86_RS07535 (JSQ86_07535) - 1527081..1527536 (+) 456 WP_204098180.1 DUF2824 family protein -
  JSQ86_RS07540 (JSQ86_07540) - 1527539..1528231 (+) 693 WP_074014732.1 DNA transfer protein -
  JSQ86_RS07545 (JSQ86_07545) - 1528241..1529572 (+) 1332 WP_027662817.1 phage DNA ejection protein -
  JSQ86_RS07550 (JSQ86_07550) - 1529573..1531966 (+) 2394 WP_204098181.1 lytic transglycosylase domain-containing protein -
  JSQ86_RS07555 (JSQ86_07555) - 1532056..1532316 (-) 261 WP_000287053.1 Arc family DNA-binding protein -
  JSQ86_RS07560 (JSQ86_07560) - 1532438..1534501 (+) 2064 WP_204098182.1 phage head-binding domain-containing protein -
  JSQ86_RS07565 (JSQ86_07565) - 1534560..1535990 (-) 1431 WP_160455551.1 glucosyltransferase domain-containing protein -
  JSQ86_RS07570 (JSQ86_07570) yfdH 1535987..1536907 (-) 921 WP_113403401.1 glycosyltransferase family 2 protein -
  JSQ86_RS07575 (JSQ86_07575) yfdG 1536904..1537266 (-) 363 WP_000915536.1 bactoprenol glucosyl transferase -
  JSQ86_RS07580 (JSQ86_07580) intS 1537419..1538576 (-) 1158 WP_021544678.1 prophage integrase IntS -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17603.43 Da        Isoelectric Point: 7.4024

>NTDB_id=536489 JSQ86_RS07340 WP_032182883.1 1504033..1504506(-) (ssb) [Escherichia coli strain E41]
MGSRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQSQQHGNHSEPPMNFDDSDIPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=536489 JSQ86_RS07340 WP_032182883.1 1504033..1504506(-) (ssb) [Escherichia coli strain E41]
ATGGGAAGTAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACCGAAGTTATCGTAGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGCCAGCAACAAA
GACAGCAATCTCAGCAGCATGGGAATCACAGCGAACCACCTATGAACTTCGACGATTCGGATATTCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

60.335

100

0.688

  ssb Glaesserella parasuis strain SC1401

50.549

100

0.586

  ssb Neisseria meningitidis MC58

41.243

100

0.465

  ssb Neisseria gonorrhoeae MS11

41.243

100

0.465