Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JQ462_RS16425 Genome accession   NZ_CP069323
Coordinates   3561981..3562478 (+) Length   165 a.a.
NCBI ID   WP_034010289.1    Uniprot ID   -
Organism   Pseudomonas aeruginosa strain R06     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3507151..3573762 3561981..3562478 within 0


Gene organization within MGE regions


Location: 3507151..3573762
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQ462_RS16160 (JQ462_16155) - 3507151..3508995 (+) 1845 WP_010794046.1 serine hydrolase domain-containing protein -
  JQ462_RS16165 (JQ462_16160) - 3509282..3509497 (-) 216 WP_003098121.1 hypothetical protein -
  JQ462_RS16175 (JQ462_16170) - 3510007..3510252 (-) 246 WP_004354886.1 hypothetical protein -
  JQ462_RS16180 (JQ462_16175) - 3510249..3510737 (-) 489 WP_059309551.1 hypothetical protein -
  JQ462_RS16185 (JQ462_16180) - 3510842..3511108 (-) 267 WP_009314099.1 hypothetical protein -
  JQ462_RS16190 - 3511146..3511775 (-) 630 WP_079760327.1 DUF4124 domain-containing protein -
  JQ462_RS16195 (JQ462_16190) - 3511852..3512445 (-) 594 WP_059309552.1 DUF1737 domain-containing protein -
  JQ462_RS16200 (JQ462_16195) - 3512456..3512977 (-) 522 WP_059309553.1 hypothetical protein -
  JQ462_RS16205 (JQ462_16200) - 3512981..3513508 (-) 528 WP_059309554.1 glycoside hydrolase family protein -
  JQ462_RS16210 (JQ462_16205) - 3513492..3513731 (-) 240 WP_004354898.1 holin -
  JQ462_RS16215 (JQ462_16210) - 3513844..3518277 (-) 4434 WP_321970250.1 PLxRFG domain-containing protein -
  JQ462_RS16220 (JQ462_16215) - 3518169..3525176 (-) 7008 WP_235180417.1 LPD23 domain-containing protein -
  JQ462_RS16225 (JQ462_16220) - 3525192..3527363 (-) 2172 WP_235175491.1 hypothetical protein -
  JQ462_RS16230 (JQ462_16225) - 3527468..3528718 (-) 1251 WP_071557749.1 DnaJ domain-containing protein -
  JQ462_RS16235 (JQ462_16230) - 3528830..3530722 (-) 1893 WP_042931354.1 hypothetical protein -
  JQ462_RS16240 (JQ462_16235) - 3530723..3531886 (-) 1164 WP_174249850.1 hypothetical protein -
  JQ462_RS16245 (JQ462_16240) - 3531879..3534476 (-) 2598 WP_124117572.1 hypothetical protein -
  JQ462_RS16250 (JQ462_16245) - 3534481..3535071 (-) 591 WP_004349221.1 hypothetical protein -
  JQ462_RS16255 (JQ462_16250) - 3535139..3536329 (-) 1191 WP_033937567.1 hypothetical protein -
  JQ462_RS16260 (JQ462_16255) - 3536329..3539292 (-) 2964 WP_059309559.1 hypothetical protein -
  JQ462_RS16265 (JQ462_16260) - 3539295..3540152 (-) 858 WP_004354920.1 hypothetical protein -
  JQ462_RS16270 (JQ462_16265) - 3540152..3540484 (-) 333 WP_177289652.1 hypothetical protein -
  JQ462_RS16275 (JQ462_16270) - 3540601..3541008 (-) 408 WP_004349209.1 hypothetical protein -
  JQ462_RS16280 (JQ462_16275) - 3540989..3541195 (-) 207 WP_004349207.1 hypothetical protein -
  JQ462_RS16285 (JQ462_16280) - 3541192..3541869 (-) 678 WP_034085194.1 DUF6682 family protein -
  JQ462_RS16290 (JQ462_16285) - 3541866..3542738 (-) 873 WP_059309560.1 RyR domain-containing protein -
  JQ462_RS16295 (JQ462_16290) - 3542803..3543282 (-) 480 WP_015975422.1 hypothetical protein -
  JQ462_RS16300 (JQ462_16295) - 3543341..3544633 (-) 1293 WP_023082376.1 DUF4043 family protein -
  JQ462_RS16305 (JQ462_16300) - 3544646..3545776 (-) 1131 WP_070147884.1 hypothetical protein -
  JQ462_RS16310 (JQ462_16305) - 3545923..3548241 (-) 2319 WP_023082375.1 hypothetical protein -
  JQ462_RS16315 (JQ462_16310) - 3548251..3549534 (-) 1284 WP_023082374.1 PBSX family phage terminase large subunit -
  JQ462_RS29210 - 3549531..3550097 (-) 567 WP_004349191.1 hypothetical protein -
  JQ462_RS16325 (JQ462_16320) - 3550250..3550474 (+) 225 WP_023980885.1 hypothetical protein -
  JQ462_RS16330 (JQ462_16325) - 3550477..3550971 (-) 495 WP_004349189.1 hypothetical protein -
  JQ462_RS16335 (JQ462_16330) - 3551050..3551664 (-) 615 Protein_3239 recombination protein NinG -
  JQ462_RS16340 (JQ462_16335) - 3551720..3552271 (-) 552 WP_023082372.1 hypothetical protein -
  JQ462_RS16345 (JQ462_16340) - 3552264..3553121 (-) 858 WP_021264627.1 hypothetical protein -
  JQ462_RS16350 - 3553108..3554076 (-) 969 WP_124117574.1 hypothetical protein -
  JQ462_RS16360 (JQ462_16355) - 3555447..3555620 (+) 174 WP_004349171.1 hypothetical protein -
  JQ462_RS16365 (JQ462_16360) - 3555900..3556163 (+) 264 WP_033991554.1 hypothetical protein -
  JQ462_RS16370 (JQ462_16365) - 3556198..3556482 (+) 285 WP_017001707.1 hypothetical protein -
  JQ462_RS16375 (JQ462_16370) - 3556545..3556757 (+) 213 WP_079389642.1 hypothetical protein -
  JQ462_RS29170 (JQ462_16375) csrA 3556792..3557163 (+) 372 WP_034051764.1 carbon storage regulator CsrA -
  JQ462_RS16385 (JQ462_16380) - 3557220..3557789 (-) 570 WP_034058628.1 hypothetical protein -
  JQ462_RS16390 (JQ462_16385) - 3557931..3558074 (+) 144 WP_023091957.1 hypothetical protein -
  JQ462_RS16395 (JQ462_16390) - 3558058..3558279 (+) 222 WP_023091958.1 hypothetical protein -
  JQ462_RS16400 (JQ462_16395) - 3558276..3558647 (+) 372 WP_004354971.1 hypothetical protein -
  JQ462_RS16405 (JQ462_16400) - 3558760..3558897 (+) 138 WP_004354975.1 hypothetical protein -
  JQ462_RS16410 (JQ462_16405) - 3558918..3559616 (+) 699 WP_023091960.1 ERF family protein -
  JQ462_RS16415 (JQ462_16410) - 3559613..3561250 (+) 1638 WP_023091961.1 YqaJ viral recombinase family protein -
  JQ462_RS16420 (JQ462_16415) - 3561372..3561977 (+) 606 WP_034010291.1 3'-5' exonuclease -
  JQ462_RS16425 (JQ462_16420) ssb 3561981..3562478 (+) 498 WP_034010289.1 single-stranded DNA-binding protein Machinery gene
  JQ462_RS16430 (JQ462_16425) rdgC 3562505..3563422 (+) 918 Protein_3257 recombination-associated protein RdgC -
  JQ462_RS16435 - 3563489..3563725 (+) 237 WP_004349416.1 DNA translocase FtsK -
  JQ462_RS16440 (JQ462_16430) - 3563831..3564145 (-) 315 WP_004355019.1 hypothetical protein -
  JQ462_RS16445 (JQ462_16435) - 3564373..3565068 (-) 696 WP_059309563.1 hypothetical protein -
  JQ462_RS16450 (JQ462_16440) - 3565189..3567102 (+) 1914 WP_059309564.1 DNA cytosine methyltransferase -
  JQ462_RS16455 (JQ462_16445) - 3567459..3568313 (-) 855 WP_124117576.1 DUF3825 domain-containing protein -
  JQ462_RS16460 (JQ462_16450) - 3568442..3568807 (-) 366 WP_124117578.1 hypothetical protein -
  JQ462_RS16465 (JQ462_16455) - 3568804..3569271 (-) 468 WP_046688615.1 hypothetical protein -
  JQ462_RS16470 (JQ462_16460) - 3569323..3569487 (+) 165 WP_153603913.1 hypothetical protein -
  JQ462_RS16475 (JQ462_16465) - 3569484..3569906 (+) 423 WP_020750790.1 hypothetical protein -
  JQ462_RS16480 (JQ462_16470) - 3569930..3570091 (+) 162 WP_171947427.1 AlpA family phage regulatory protein -
  JQ462_RS16485 - 3570164..3570400 (-) 237 Protein_3268 hypothetical protein -
  JQ462_RS16490 (JQ462_16475) - 3570440..3570982 (-) 543 WP_124117580.1 hypothetical protein -
  JQ462_RS16495 (JQ462_16480) - 3570969..3571316 (-) 348 WP_079386696.1 STAS-like domain-containing protein -
  JQ462_RS16500 (JQ462_16485) - 3571322..3572422 (-) 1101 WP_124117583.1 hypothetical protein -
  JQ462_RS16505 (JQ462_16490) - 3572530..3573762 (-) 1233 WP_004355264.1 integrase arm-type DNA-binding domain-containing protein -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18519.55 Da        Isoelectric Point: 6.9906

>NTDB_id=533545 JQ462_RS16425 WP_034010289.1 3561981..3562478(+) (ssb) [Pseudomonas aeruginosa strain R06]
MARGVNKVILVGHLGQDPDARSTPSGKAVTSLSLATSESWKDKQTGQQQERTEWHRVVLFGRLAEIAAQYLRKGSQVYIE
GSLRTRKWQGQDGQDHYSTEVVVDINGNMQLLGGKPEQAGQSRGPGREPPPRPTTHHQPQPATDYDSYDDDIPFDDPYRL
LWRLV

Nucleotide


Download         Length: 498 bp        

>NTDB_id=533545 JQ462_RS16425 WP_034010289.1 3561981..3562478(+) (ssb) [Pseudomonas aeruginosa strain R06]
ATGGCACGCGGAGTGAACAAGGTAATCCTGGTCGGCCATCTGGGCCAGGATCCAGACGCAAGATCTACCCCCAGCGGGAA
GGCAGTTACGTCCCTCAGCCTGGCCACTAGCGAAAGCTGGAAAGACAAGCAGACCGGCCAGCAGCAGGAGCGCACCGAGT
GGCACCGGGTCGTGCTCTTTGGCCGGCTGGCCGAAATCGCAGCGCAATACCTGCGAAAGGGCTCCCAGGTCTACATCGAA
GGCAGCCTACGCACCCGCAAGTGGCAGGGCCAGGACGGCCAGGACCACTACAGCACCGAGGTAGTGGTGGACATCAACGG
CAACATGCAACTGCTCGGCGGCAAGCCTGAGCAGGCAGGCCAGTCGCGTGGCCCTGGCCGCGAGCCGCCACCGCGGCCGA
CCACTCACCACCAGCCGCAACCGGCAACCGACTACGACAGCTACGACGACGACATTCCGTTCGATGACCCCTATCGCCTG
CTCTGGCGTCTCGTGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

53.933

100

0.582

  ssb Glaesserella parasuis strain SC1401

47.514

100

0.521

  ssb Neisseria meningitidis MC58

41.477

100

0.442

  ssb Neisseria gonorrhoeae MS11

41.477

100

0.442