Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JL661_RS00650 Genome accession   NZ_CP069157
Coordinates   127609..128130 (+) Length   173 a.a.
NCBI ID   WP_004238253.1    Uniprot ID   J7TBA8
Organism   Morganella morganii strain DSM 30164     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 70626..128130 127609..128130 within 0


Gene organization within MGE regions


Location: 70626..128130
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JL661_RS00295 (JL661_00295) lexA 70626..71240 (+) 615 WP_004238270.1 transcriptional repressor LexA -
  JL661_RS00300 (JL661_00300) zur 71319..71837 (-) 519 WP_049245999.1 zinc uptake transcriptional repressor Zur -
  JL661_RS00305 (JL661_00305) - 72014..72484 (+) 471 WP_004238268.1 YbaK/EbsC family protein -
  JL661_RS00310 (JL661_00310) - 72520..72873 (-) 354 WP_004241537.1 helix-turn-helix transcriptional regulator -
  JL661_RS00315 (JL661_00315) - 72928..73140 (-) 213 WP_004241538.1 helix-turn-helix transcriptional regulator -
  JL661_RS00320 (JL661_00320) - 73900..75081 (+) 1182 WP_036418970.1 multidrug effflux MFS transporter -
  JL661_RS00325 (JL661_00325) - 75467..75937 (-) 471 WP_073970200.1 oxidoreductase -
  JL661_RS00330 (JL661_00330) - 75937..76638 (-) 702 WP_062773583.1 DUF3800 domain-containing protein -
  JL661_RS00335 (JL661_00335) - 76743..76994 (-) 252 WP_062773519.1 pyocin activator PrtN family protein -
  JL661_RS18215 - 77025..77375 (-) 351 WP_247718691.1 hypothetical protein -
  JL661_RS00340 (JL661_00340) - 77352..77867 (-) 516 Protein_63 YfbR-like 5'-deoxynucleotidase -
  JL661_RS00345 (JL661_00345) - 77910..78137 (-) 228 WP_062773522.1 hypothetical protein -
  JL661_RS00350 (JL661_00350) - 78236..79063 (-) 828 WP_062773524.1 DUF2303 family protein -
  JL661_RS00355 (JL661_00355) - 79129..79491 (-) 363 WP_062773527.1 hypothetical protein -
  JL661_RS00360 (JL661_00360) - 79713..79925 (-) 213 WP_062773530.1 hypothetical protein -
  JL661_RS00365 (JL661_00365) - 80077..80964 (+) 888 WP_062773533.1 BRCT domain-containing protein -
  JL661_RS00370 (JL661_00370) - 80950..81636 (-) 687 WP_062773535.1 helix-turn-helix transcriptional regulator -
  JL661_RS00375 (JL661_00375) - 81762..81998 (+) 237 WP_024475202.1 YdaS family helix-turn-helix protein -
  JL661_RS00380 (JL661_00380) - 82056..82715 (+) 660 WP_150974899.1 hypothetical protein -
  JL661_RS00385 (JL661_00385) - 82739..83236 (+) 498 WP_150974898.1 YmfL family putative regulatory protein -
  JL661_RS00390 (JL661_00390) - 83301..83492 (+) 192 WP_062773544.1 hypothetical protein -
  JL661_RS00395 (JL661_00395) - 83489..83677 (+) 189 WP_046024011.1 DUF4222 domain-containing protein -
  JL661_RS00400 (JL661_00400) - 83674..84813 (+) 1140 WP_062773547.1 hypothetical protein -
  JL661_RS00405 (JL661_00405) - 84810..85058 (+) 249 WP_062773550.1 hypothetical protein -
  JL661_RS00410 (JL661_00410) - 85058..85594 (+) 537 WP_062773553.1 phage N-6-adenine-methyltransferase -
  JL661_RS00415 (JL661_00415) - 85591..85872 (+) 282 WP_218480998.1 hypothetical protein -
  JL661_RS00425 (JL661_00425) - 86266..86757 (+) 492 WP_150974897.1 hypothetical protein -
  JL661_RS00430 (JL661_00430) - 86857..87645 (+) 789 WP_062773561.1 KilA-N domain-containing protein -
  JL661_RS00435 (JL661_00435) - 87645..88661 (+) 1017 WP_062773564.1 DUF968 domain-containing protein -
  JL661_RS00440 (JL661_00440) - 88692..89369 (+) 678 WP_062773569.1 bacteriophage antitermination protein Q -
  JL661_RS00445 (JL661_00445) - 90004..90300 (+) 297 WP_150974950.1 hypothetical protein -
  JL661_RS00450 (JL661_00450) - 90350..90904 (-) 555 WP_049246077.1 hypothetical protein -
  JL661_RS00455 (JL661_00455) - 90925..91236 (+) 312 WP_062773576.1 hypothetical protein -
  JL661_RS00460 (JL661_00460) - 91479..91670 (+) 192 WP_062773578.1 phage holin family protein -
  JL661_RS00465 (JL661_00465) - 91663..92139 (+) 477 WP_151298199.1 lysozyme -
  JL661_RS00470 (JL661_00470) - 92121..92279 (+) 159 WP_164091680.1 hypothetical protein -
  JL661_RS00475 (JL661_00475) - 92276..92728 (+) 453 WP_062773665.1 lysis protein -
  JL661_RS00480 (JL661_00480) - 92757..92942 (+) 186 WP_004242385.1 hypothetical protein -
  JL661_RS00485 (JL661_00485) - 93266..93769 (+) 504 WP_024474667.1 DUF1441 family protein -
  JL661_RS00490 (JL661_00490) - 93766..95879 (+) 2114 Protein_92 phage terminase large subunit family protein -
  JL661_RS00495 (JL661_00495) - 95876..96094 (+) 219 WP_004242389.1 hypothetical protein -
  JL661_RS00500 (JL661_00500) - 96091..97566 (+) 1476 WP_151298198.1 phage portal protein -
  JL661_RS00505 (JL661_00505) - 97538..99574 (+) 2037 WP_062773636.1 ClpP-like prohead protease/major capsid protein fusion protein -
  JL661_RS00510 (JL661_00510) - 99660..100001 (+) 342 WP_024474671.1 capsid cement protein -
  JL661_RS00515 (JL661_00515) - 100006..100284 (+) 279 WP_062773633.1 ATP-binding protein -
  JL661_RS00520 (JL661_00520) - 100286..100849 (+) 564 WP_024474672.1 phage tail protein -
  JL661_RS00525 (JL661_00525) - 100849..101247 (+) 399 WP_004242399.1 phage minor tail U family protein -
  JL661_RS00530 (JL661_00530) - 101257..101721 (+) 465 Protein_100 phage tail tube protein -
  JL661_RS00535 (JL661_00535) - 101788..102186 (+) 399 WP_004242401.1 phage minor tail protein G -
  JL661_RS00540 (JL661_00540) - 102252..102518 (+) 267 WP_004242403.1 phage tail assembly protein T -
  JL661_RS00545 (JL661_00545) - 102499..104874 (+) 2376 WP_218480999.1 phage tail length tape measure family protein -
  JL661_RS00550 (JL661_00550) - 104915..105427 (+) 513 WP_247709716.1 phage tail tape measure C-terminal domain-containing protein -
  JL661_RS00555 (JL661_00555) - 105430..105759 (+) 330 WP_004242405.1 phage tail protein -
  JL661_RS00560 (JL661_00560) - 106262..107044 (+) 783 WP_004242407.1 KilA-N domain-containing protein -
  JL661_RS00565 (JL661_00565) - 107056..107754 (+) 699 WP_062773628.1 phage minor tail protein L -
  JL661_RS00570 (JL661_00570) - 107772..108500 (+) 729 WP_004242409.1 C40 family peptidase -
  JL661_RS00575 (JL661_00575) - 108404..109049 (+) 646 Protein_109 tail assembly protein -
  JL661_RS00580 (JL661_00580) - 109062..112223 (+) 3162 WP_205439564.1 host specificity protein J -
  JL661_RS00585 (JL661_00585) - 112223..112585 (+) 363 WP_205814257.1 hypothetical protein -
  JL661_RS00590 (JL661_00590) - 112587..113201 (+) 615 WP_036421961.1 hypothetical protein -
  JL661_RS18220 - 113267..114847 (+) 1581 WP_062773493.1 hypothetical protein -
  JL661_RS00600 (JL661_00600) - 115013..115957 (-) 945 WP_024475195.1 hypothetical protein -
  JL661_RS00605 (JL661_00605) - 116271..117353 (-) 1083 WP_062773495.1 site-specific integrase -
  JL661_RS00610 (JL661_00610) dusA 117443..118489 (+) 1047 WP_036418952.1 tRNA dihydrouridine(20/20a) synthase DusA -
  JL661_RS00615 (JL661_00615) - 118540..118854 (-) 315 WP_004241541.1 hypothetical protein -
  JL661_RS00620 (JL661_00620) - 119016..119999 (-) 984 WP_004238260.1 quinone oxidoreductase -
  JL661_RS00625 (JL661_00625) dnaB 120232..121638 (+) 1407 WP_015422419.1 replicative DNA helicase -
  JL661_RS00630 (JL661_00630) alr 121718..122797 (+) 1080 WP_036418946.1 alanine racemase -
  JL661_RS00635 (JL661_00635) - 122853..124049 (+) 1197 WP_036418943.1 amino acid aminotransferase -
  JL661_RS00640 (JL661_00640) - 124101..124367 (-) 267 WP_036418940.1 DksA/TraR family C4-type zinc finger protein -
  JL661_RS00645 (JL661_00645) uvrA 124499..127332 (-) 2834 Protein_123 excinuclease ABC subunit UvrA -
  JL661_RS00650 (JL661_00650) ssb 127609..128130 (+) 522 WP_004238253.1 single-stranded DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 173 a.a.        Molecular weight: 18770.82 Da        Isoelectric Point: 4.9567

>NTDB_id=532504 JL661_RS00650 WP_004238253.1 127609..128130(+) (ssb) [Morganella morganii strain DSM 30164]
MASRGVNKVILIGNLGQDPEVRYMPNGGAVTNITLATSESWRDKQTGEMKEKTEWHRVVIFGKLAEIAGEYLKKGSQVYI
EGSLQTRKWQDQSGQERYTTEVVVNIGGSMQMLGGRSGGGDNMSQGGGWGQPQQPQQSQQFSGGGNPRPAQQPAAAAPQS
NEPPMDFDDDIPF

Nucleotide


Download         Length: 522 bp        

>NTDB_id=532504 JL661_RS00650 WP_004238253.1 127609..128130(+) (ssb) [Morganella morganii strain DSM 30164]
ATGGCCAGCAGAGGCGTCAACAAAGTCATTCTTATCGGGAACCTGGGTCAGGATCCGGAAGTGCGTTACATGCCTAACGG
CGGTGCGGTTACCAACATCACACTGGCGACATCAGAATCATGGCGTGATAAACAAACCGGCGAAATGAAAGAGAAGACCG
AATGGCACCGTGTGGTGATCTTCGGCAAACTGGCAGAAATTGCCGGTGAATATCTGAAAAAAGGTTCACAGGTTTATATC
GAAGGTTCACTCCAGACCCGCAAATGGCAGGATCAGAGCGGCCAGGAGCGTTACACCACAGAAGTCGTGGTGAATATCGG
CGGCAGCATGCAGATGCTGGGCGGCCGCAGCGGCGGTGGCGACAATATGTCTCAGGGCGGCGGCTGGGGTCAGCCACAGC
AGCCACAACAATCCCAGCAGTTCAGCGGCGGCGGCAACCCGCGCCCGGCACAGCAGCCGGCAGCAGCAGCGCCGCAAAGC
AATGAACCGCCAATGGATTTCGATGACGATATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB J7TBA8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

69.73

100

0.746

  ssb Glaesserella parasuis strain SC1401

57.297

100

0.613

  ssb Neisseria meningitidis MC58

48.864

100

0.497

  ssb Neisseria gonorrhoeae MS11

48.864

100

0.497