Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JKV48_RS04665 Genome accession   NZ_CP068682
Coordinates   964321..964791 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain NCCP11854     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 954226..996654 964321..964791 within 0


Gene organization within MGE regions


Location: 954226..996654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JKV48_RS04575 (JKV48_04550) - 954226..955431 (-) 1206 WP_000264751.1 tyrosine-type recombinase/integrase -
  JKV48_RS04580 (JKV48_04555) - 955557..956171 (+) 615 WP_000191458.1 hypothetical protein -
  JKV48_RS04585 (JKV48_04560) - 956168..956314 (-) 147 WP_001013104.1 hypothetical protein -
  JKV48_RS04590 (JKV48_04565) - 956350..956532 (-) 183 WP_000705240.1 hypothetical protein -
  JKV48_RS04595 (JKV48_04570) - 956602..957321 (-) 720 WP_000358224.1 XRE family transcriptional regulator -
  JKV48_RS04600 (JKV48_04575) - 957463..957681 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  JKV48_RS04605 (JKV48_04580) - 957697..958473 (+) 777 WP_001148544.1 Rha family transcriptional regulator -
  JKV48_RS04610 (JKV48_04585) - 958502..958747 (+) 246 WP_001025401.1 DUF2829 domain-containing protein -
  JKV48_RS04615 (JKV48_04590) - 958716..959081 (-) 366 WP_001128433.1 hypothetical protein -
  JKV48_RS04620 (JKV48_04595) - 959136..959351 (+) 216 WP_001097552.1 hypothetical protein -
  JKV48_RS04625 (JKV48_04600) - 959378..959641 (+) 264 WP_001124198.1 helix-turn-helix domain-containing protein -
  JKV48_RS04630 (JKV48_04605) - 959653..959814 (+) 162 WP_031833131.1 DUF1270 domain-containing protein -
  JKV48_RS04635 (JKV48_04610) - 959909..960211 (+) 303 WP_000165371.1 DUF2482 family protein -
  JKV48_RS04640 (JKV48_04615) - 960216..960476 (+) 261 WP_000291510.1 DUF1108 family protein -
  JKV48_RS04645 (JKV48_04620) - 960485..960748 (+) 264 WP_001205732.1 hypothetical protein -
  JKV48_RS04650 (JKV48_04625) - 960757..962700 (+) 1944 WP_000700554.1 AAA family ATPase -
  JKV48_RS04655 (JKV48_04630) - 962702..963622 (+) 921 WP_000180600.1 recombinase RecT -
  JKV48_RS04660 (JKV48_04635) - 963703..964320 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  JKV48_RS04665 (JKV48_04640) ssbA 964321..964791 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  JKV48_RS04670 (JKV48_04645) - 964821..965714 (+) 894 WP_000148333.1 DnaD domain protein -
  JKV48_RS04675 (JKV48_04650) - 965721..965939 (+) 219 WP_000338528.1 hypothetical protein -
  JKV48_RS04680 (JKV48_04655) - 965948..966352 (+) 405 Protein_930 RusA family crossover junction endodeoxyribonuclease -
  JKV48_RS04685 (JKV48_04660) - 966365..966736 (+) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  JKV48_RS04690 (JKV48_04665) - 966736..966993 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  JKV48_RS04695 (JKV48_04670) - 966996..967238 (+) 243 WP_000221877.1 SAV1978 family virulence-associated passenger protein -
  JKV48_RS13595 - 967253..967378 (+) 126 Protein_934 DUF1024 family protein -
  JKV48_RS04705 (JKV48_04680) - 967734..968264 (+) 531 WP_235103126.1 dUTPase -
  JKV48_RS04710 (JKV48_04685) - 968301..968474 (+) 174 WP_001209219.1 hypothetical protein -
  JKV48_RS04715 (JKV48_04690) - 968491..968679 (+) 189 WP_000195823.1 DUF1381 domain-containing protein -
  JKV48_RS04720 (JKV48_04695) - 968654..968854 (+) 201 WP_001125015.1 hypothetical protein -
  JKV48_RS04725 (JKV48_04700) rinB 968857..969009 (+) 153 WP_000237866.1 transcriptional activator RinB -
  JKV48_RS04730 (JKV48_04705) - 969077..969277 (+) 201 WP_000265258.1 DUF1514 family protein -
  JKV48_RS04735 (JKV48_04710) - 969329..969655 (+) 327 Protein_941 hypothetical protein -
  JKV48_RS04740 (JKV48_04715) - 969655..970566 (+) 912 Protein_942 SNF2-related protein -
  JKV48_RS04745 (JKV48_04720) - 970579..971016 (+) 438 WP_053507569.1 transcriptional regulator -
  JKV48_RS04750 (JKV48_04725) - 971178..971492 (+) 315 WP_000196700.1 HNH endonuclease -
  JKV48_RS04755 (JKV48_04730) - 971619..971924 (+) 306 WP_000778930.1 P27 family phage terminase small subunit -
  JKV48_RS04760 (JKV48_04735) - 971914..973605 (+) 1692 WP_000153549.1 terminase large subunit -
  JKV48_RS04765 (JKV48_04740) - 973610..974848 (+) 1239 WP_001100669.1 phage portal protein -
  JKV48_RS04770 (JKV48_04745) - 974832..975605 (+) 774 WP_000061872.1 head maturation protease, ClpP-related -
  JKV48_RS04775 (JKV48_04750) - 975617..976780 (+) 1164 WP_001142739.1 phage major capsid protein -
  JKV48_RS04780 (JKV48_04755) - 976849..977127 (+) 279 WP_000050973.1 head-tail connector protein -
  JKV48_RS04785 (JKV48_04760) - 977139..977471 (+) 333 WP_031838176.1 phage protein -
  JKV48_RS04790 (JKV48_04765) - 977468..977869 (+) 402 WP_000110023.1 hypothetical protein -
  JKV48_RS04795 (JKV48_04770) - 977870..978265 (+) 396 WP_001023806.1 DUF3168 domain-containing protein -
  JKV48_RS04800 (JKV48_04775) - 978300..978941 (+) 642 WP_000807536.1 major tail protein -
  JKV48_RS04805 (JKV48_04780) - 979033..979488 (+) 456 WP_000169128.1 Ig-like domain-containing protein -
  JKV48_RS04810 (JKV48_04785) gpG 979546..979887 (+) 342 WP_000589166.1 phage tail assembly chaperone G -
  JKV48_RS04815 (JKV48_04790) - 979938..980096 (+) 159 WP_000438833.1 hypothetical protein -
  JKV48_RS04820 (JKV48_04795) - 980110..986310 (+) 6201 WP_031900279.1 phage tail tape measure protein -
  JKV48_RS04825 (JKV48_04800) - 986310..987134 (+) 825 WP_001190533.1 phage tail family protein -
  JKV48_RS04830 (JKV48_04805) - 987143..988726 (+) 1584 WP_000384462.1 prophage endopeptidase tail family protein -
  JKV48_RS04835 (JKV48_04810) - 988726..989016 (+) 291 WP_000179860.1 hypothetical protein -
  JKV48_RS04840 (JKV48_04815) - 989032..990942 (+) 1911 WP_000429551.1 minor structural protein -
  JKV48_RS04845 (JKV48_04820) - 990942..992408 (+) 1467 WP_031900278.1 BppU family phage baseplate upper protein -
  JKV48_RS04850 (JKV48_04825) - 992408..992797 (+) 390 WP_001166599.1 DUF2977 domain-containing protein -
  JKV48_RS04855 (JKV48_04830) - 992790..992954 (+) 165 WP_000916020.1 XkdX family protein -
  JKV48_RS04860 (JKV48_04835) - 993000..993299 (+) 300 WP_000466784.1 DUF2951 domain-containing protein -
  JKV48_RS04865 (JKV48_04840) - 993435..993737 (+) 303 WP_000339141.1 phage holin -
  JKV48_RS04870 (JKV48_04845) - 993748..995202 (+) 1455 WP_000909210.1 N-acetylmuramoyl-L-alanine amidase -
  JKV48_RS04875 (JKV48_04850) - 995818..996654 (+) 837 WP_000675478.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=530347 JKV48_RS04665 WP_000934759.1 964321..964791(+) (ssbA) [Staphylococcus aureus strain NCCP11854]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=530347 JKV48_RS04665 WP_000934759.1 964321..964791(+) (ssbA) [Staphylococcus aureus strain NCCP11854]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365