Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JJQ57_RS22725 Genome accession   NZ_CP068239
Coordinates   4788182..4788643 (+) Length   153 a.a.
NCBI ID   WP_023127335.1    Uniprot ID   -
Organism   Pseudomonas aeruginosa strain PA19-3047     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4740247..4797478 4788182..4788643 within 0


Gene organization within MGE regions


Location: 4740247..4797478
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JJQ57_RS22400 (JJQ57_22400) wapB 4740247..4741239 (-) 993 WP_073660296.1 1,2-glucosyltransferase WapB -
  JJQ57_RS22405 (JJQ57_22405) - 4741782..4742045 (-) 264 WP_023098716.1 hypothetical protein -
  JJQ57_RS22410 (JJQ57_22410) - 4742081..4742344 (-) 264 WP_023098717.1 hypothetical protein -
  JJQ57_RS22415 (JJQ57_22415) - 4742341..4742709 (-) 369 WP_023098718.1 hypothetical protein -
  JJQ57_RS22420 (JJQ57_22420) - 4742706..4743335 (-) 630 WP_023098719.1 glycoside hydrolase family 19 protein -
  JJQ57_RS22425 (JJQ57_22425) - 4743400..4745457 (-) 2058 WP_071537765.1 structural protein -
  JJQ57_RS22430 (JJQ57_22430) - 4745516..4748239 (-) 2724 WP_023098721.1 host specificity factor TipJ family phage tail protein -
  JJQ57_RS22435 (JJQ57_22435) - 4748211..4748618 (-) 408 WP_014603776.1 hypothetical protein -
  JJQ57_RS22440 (JJQ57_22440) - 4748623..4749114 (-) 492 WP_023098722.1 DUF1833 family protein -
  JJQ57_RS22445 (JJQ57_22445) - 4749098..4749577 (-) 480 WP_033936236.1 hypothetical protein -
  JJQ57_RS22450 (JJQ57_22450) - 4749574..4752024 (-) 2451 WP_033936239.1 phage tail length tape measure family protein -
  JJQ57_RS22455 (JJQ57_22455) - 4752351..4752710 (-) 360 WP_033936240.1 phage tail assembly chaperone family protein, TAC -
  JJQ57_RS22460 (JJQ57_22460) - 4752720..4753241 (-) 522 WP_033936241.1 phage tail tube protein -
  JJQ57_RS22465 (JJQ57_22465) - 4753316..4753681 (-) 366 WP_003101017.1 DUF3168 domain-containing protein -
  JJQ57_RS22470 (JJQ57_22470) - 4753681..4754163 (-) 483 WP_003101018.1 HK97-gp10 family putative phage morphogenesis protein -
  JJQ57_RS22475 (JJQ57_22475) - 4754156..4754773 (-) 618 WP_023098728.1 methyltransferase domain-containing protein -
  JJQ57_RS22480 (JJQ57_22480) - 4754770..4754955 (-) 186 WP_015648614.1 hypothetical protein -
  JJQ57_RS22485 (JJQ57_22485) - 4754952..4755785 (-) 834 WP_015648613.1 hypothetical protein -
  JJQ57_RS22490 (JJQ57_22490) - 4755789..4756151 (-) 363 WP_015648612.1 Gp49 family protein -
  JJQ57_RS22495 (JJQ57_22495) - 4756213..4756785 (-) 573 WP_023098729.1 GIY-YIG nuclease family protein -
  JJQ57_RS22500 (JJQ57_22500) - 4756904..4757260 (-) 357 WP_031630036.1 phage head closure protein -
  JJQ57_RS22505 (JJQ57_22505) - 4757261..4757581 (-) 321 WP_012614021.1 head-tail connector protein -
  JJQ57_RS22510 (JJQ57_22510) - 4757562..4757966 (-) 405 WP_169309829.1 hypothetical protein -
  JJQ57_RS22515 (JJQ57_22515) - 4758325..4759512 (-) 1188 WP_023098730.1 phage major capsid protein -
  JJQ57_RS22520 (JJQ57_22520) - 4759509..4760399 (-) 891 WP_023098731.1 head maturation protease, ClpP-related -
  JJQ57_RS22525 (JJQ57_22525) - 4760403..4761707 (-) 1305 WP_031630043.1 phage portal protein -
  JJQ57_RS22530 (JJQ57_22530) - 4761700..4761864 (-) 165 WP_003088450.1 hypothetical protein -
  JJQ57_RS22535 (JJQ57_22535) - 4761861..4763552 (-) 1692 WP_023098733.1 terminase large subunit -
  JJQ57_RS22540 (JJQ57_22540) - 4763554..4763934 (-) 381 WP_023098734.1 hypothetical protein -
  JJQ57_RS22545 (JJQ57_22545) - 4764147..4764461 (-) 315 WP_033936245.1 HNH endonuclease -
  JJQ57_RS22550 (JJQ57_22550) - 4764962..4765180 (-) 219 WP_033936247.1 hypothetical protein -
  JJQ57_RS22555 (JJQ57_22555) - 4765549..4765833 (-) 285 WP_033936248.1 phage holin family protein -
  JJQ57_RS22560 (JJQ57_22560) - 4765826..4766194 (-) 369 WP_033936249.1 putative holin -
  JJQ57_RS22575 (JJQ57_22575) - 4766550..4767773 (+) 1224 WP_023098737.1 RNA-guided endonuclease InsQ/TnpB family protein -
  JJQ57_RS22585 (JJQ57_22585) - 4768332..4769018 (-) 687 WP_023098998.1 hypothetical protein -
  JJQ57_RS22590 (JJQ57_22590) - 4769015..4769599 (-) 585 WP_033936255.1 recombination protein NinG -
  JJQ57_RS22595 (JJQ57_22595) - 4769596..4770066 (-) 471 WP_033936256.1 hypothetical protein -
  JJQ57_RS22600 (JJQ57_22600) - 4770059..4770265 (-) 207 WP_033936257.1 TraR/DksA family transcriptional regulator -
  JJQ57_RS22605 (JJQ57_22605) - 4770267..4770749 (-) 483 WP_169309828.1 hypothetical protein -
  JJQ57_RS22610 (JJQ57_22610) - 4770889..4771575 (-) 687 WP_023093580.1 hypothetical protein -
  JJQ57_RS22615 (JJQ57_22615) dnaB 4771575..4772915 (-) 1341 WP_023093581.1 replicative DNA helicase -
  JJQ57_RS22620 (JJQ57_22620) - 4772912..4773901 (-) 990 WP_033936259.1 replication protein -
  JJQ57_RS22625 (JJQ57_22625) - 4774095..4774667 (-) 573 WP_033936260.1 hypothetical protein -
  JJQ57_RS22630 (JJQ57_22630) - 4774703..4774900 (-) 198 WP_012614002.1 Cro/CI family transcriptional regulator -
  JJQ57_RS22635 (JJQ57_22635) - 4775055..4775822 (+) 768 WP_226008432.1 helix-turn-helix transcriptional regulator -
  JJQ57_RS22640 (JJQ57_22640) - 4775995..4777035 (+) 1041 WP_033936262.1 ParA family protein -
  JJQ57_RS22645 (JJQ57_22645) - 4777421..4778074 (+) 654 WP_169309827.1 zinc ribbon domain-containing protein -
  JJQ57_RS22650 (JJQ57_22650) - 4778427..4778729 (+) 303 WP_169309826.1 hypothetical protein -
  JJQ57_RS22655 (JJQ57_22655) - 4778739..4778945 (+) 207 WP_023657539.1 hypothetical protein -
  JJQ57_RS22660 (JJQ57_22660) - 4779244..4780539 (+) 1296 WP_236675786.1 hypothetical protein -
  JJQ57_RS22665 (JJQ57_22665) - 4780760..4781251 (+) 492 WP_023098759.1 hypothetical protein -
  JJQ57_RS22670 (JJQ57_22670) - 4781545..4781877 (+) 333 WP_123906742.1 hypothetical protein -
  JJQ57_RS22675 (JJQ57_22675) - 4781912..4782151 (+) 240 WP_023098761.1 hypothetical protein -
  JJQ57_RS22680 (JJQ57_22680) - 4782369..4782593 (+) 225 WP_023098762.1 hypothetical protein -
  JJQ57_RS22685 (JJQ57_22685) - 4782590..4782955 (+) 366 WP_023098763.1 hypothetical protein -
  JJQ57_RS22690 (JJQ57_22690) - 4782990..4784135 (-) 1146 WP_010792309.1 RNA-guided endonuclease InsQ/TnpB family protein -
  JJQ57_RS22695 (JJQ57_22695) - 4784266..4784778 (+) 513 WP_023657541.1 hypothetical protein -
  JJQ57_RS22700 (JJQ57_22700) - 4784885..4785916 (+) 1032 WP_023098765.1 DNA cytosine methyltransferase -
  JJQ57_RS22705 (JJQ57_22705) - 4785913..4786050 (+) 138 WP_023098766.1 hypothetical protein -
  JJQ57_RS22710 (JJQ57_22710) - 4786201..4786506 (+) 306 WP_023657542.1 hypothetical protein -
  JJQ57_RS22715 (JJQ57_22715) - 4786549..4787358 (+) 810 WP_023127333.1 PD-(D/E)XK nuclease-like domain-containing protein -
  JJQ57_RS22720 (JJQ57_22720) - 4787355..4788185 (+) 831 WP_023127334.1 hypothetical protein -
  JJQ57_RS22725 (JJQ57_22725) ssb 4788182..4788643 (+) 462 WP_023127335.1 single-stranded DNA-binding protein Machinery gene
  JJQ57_RS22730 (JJQ57_22730) - 4788707..4789306 (+) 600 WP_023127336.1 hypothetical protein -
  JJQ57_RS22735 (JJQ57_22735) - 4789469..4789693 (+) 225 WP_023127337.1 hypothetical protein -
  JJQ57_RS22740 (JJQ57_22740) - 4789702..4790832 (+) 1131 WP_197541269.1 hypothetical protein -
  JJQ57_RS32640 - 4790832..4791281 (+) 450 WP_023098773.1 hypothetical protein -
  JJQ57_RS22750 (JJQ57_22750) - 4791274..4791717 (+) 444 WP_023098774.1 hypothetical protein -
  JJQ57_RS22755 (JJQ57_22755) - 4791710..4792006 (+) 297 WP_023098775.1 Lar family restriction alleviation protein -
  JJQ57_RS22760 (JJQ57_22760) - 4792325..4792768 (+) 444 WP_023098776.1 hypothetical protein -
  JJQ57_RS22765 (JJQ57_22765) - 4792761..4793042 (+) 282 WP_023098777.1 hypothetical protein -
  JJQ57_RS22770 (JJQ57_22770) - 4793235..4793891 (+) 657 WP_023098778.1 hypothetical protein -
  JJQ57_RS22775 (JJQ57_22775) - 4793888..4794223 (+) 336 WP_023098779.1 hypothetical protein -
  JJQ57_RS22780 (JJQ57_22780) - 4794220..4794381 (+) 162 WP_162836351.1 hypothetical protein -
  JJQ57_RS32645 - 4794472..4794717 (+) 246 WP_023098780.1 hypothetical protein -
  JJQ57_RS22785 (JJQ57_22785) - 4794714..4795688 (-) 975 WP_031630076.1 tyrosine-type recombinase/integrase -
  JJQ57_RS22795 (JJQ57_22795) purC 4795981..4796691 (-) 711 WP_003086275.1 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
  JJQ57_RS22800 (JJQ57_22800) - 4796720..4797478 (-) 759 WP_003086273.1 MBL fold metallo-hydrolase -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 17113.94 Da        Isoelectric Point: 6.4768

>NTDB_id=528461 JJQ57_RS22725 WP_023127335.1 4788182..4788643(+) (ssb) [Pseudomonas aeruginosa strain PA19-3047]
MSRGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESWKDKQTGQQQERAEFHRVVFFGRLAEIAGEYLRKGSQVYVE
GSLRTRKWQGQDGQDRYTTEVIVDMHGQMQMLGGKPVNDQAAQSRQSPQQQSAPQQRPQVAQANDSFDDDIPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=528461 JJQ57_RS22725 WP_023127335.1 4788182..4788643(+) (ssb) [Pseudomonas aeruginosa strain PA19-3047]
ATGAGCCGTGGAGTGAACAAAGTAATCCTGGTCGGCAACGTCGGTGGTGACCCGGAAACCCGCTACATGCCCAACGGCAA
TGCGGTGACCAACATCACCCTCGCCACCAGCGAGAGCTGGAAGGACAAGCAGACCGGCCAGCAACAGGAACGCGCCGAGT
TCCACCGCGTGGTGTTCTTCGGTCGCCTGGCGGAGATCGCCGGCGAGTACCTGCGCAAGGGTTCCCAGGTCTACGTCGAA
GGCAGCCTGCGCACACGTAAGTGGCAGGGCCAGGACGGTCAGGATCGCTACACCACCGAGGTAATCGTCGACATGCACGG
ACAGATGCAGATGCTTGGCGGAAAGCCTGTAAATGACCAGGCGGCTCAGAGCAGGCAATCTCCTCAGCAGCAGAGCGCAC
CGCAGCAGCGCCCGCAGGTTGCGCAGGCTAACGACAGCTTCGACGACGATATCCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.714

100

0.66

  ssb Glaesserella parasuis strain SC1401

50.276

100

0.595

  ssb Neisseria meningitidis MC58

42.614

100

0.49

  ssb Neisseria gonorrhoeae MS11

42.614

100

0.49