Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I6I42_RS00665 Genome accession   NZ_CP068145
Coordinates   151384..151905 (-) Length   173 a.a.
NCBI ID   WP_004238253.1    Uniprot ID   J7TBA8
Organism   Morganella morganii strain FDAARGOS_1085     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 151384..209527 151384..151905 within 0


Gene organization within MGE regions


Location: 151384..209527
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6I42_RS00665 (I6I42_00665) ssb 151384..151905 (-) 522 WP_004238253.1 single-stranded DNA-binding protein Machinery gene
  I6I42_RS00670 (I6I42_00670) uvrA 152184..155018 (+) 2835 WP_201893458.1 excinuclease ABC subunit UvrA -
  I6I42_RS00675 (I6I42_00675) - 155408..155674 (+) 267 WP_004241544.1 DksA/TraR family C4-type zinc finger protein -
  I6I42_RS00680 (I6I42_00680) - 155726..156922 (-) 1197 WP_024475191.1 amino acid aminotransferase -
  I6I42_RS00685 (I6I42_00685) alr 156978..158057 (-) 1080 WP_024475192.1 alanine racemase -
  I6I42_RS00690 (I6I42_00690) dnaB 158137..159543 (-) 1407 WP_015422419.1 replicative DNA helicase -
  I6I42_RS00695 (I6I42_00695) - 159776..160759 (+) 984 WP_004238260.1 quinone oxidoreductase -
  I6I42_RS00700 (I6I42_00700) dusA 160824..161870 (-) 1047 WP_201893460.1 tRNA dihydrouridine(20/20a) synthase DusA -
  I6I42_RS00705 (I6I42_00705) - 161969..163051 (+) 1083 WP_201893462.1 site-specific integrase -
  I6I42_RS18740 - 163373..163849 (-) 477 WP_236595586.1 hypothetical protein -
  I6I42_RS00715 (I6I42_00715) umuC 164213..165475 (-) 1263 WP_201893464.1 translesion error-prone DNA polymerase V subunit UmuC -
  I6I42_RS00720 (I6I42_00720) umuD 165475..165891 (-) 417 WP_201893467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  I6I42_RS00725 (I6I42_00725) - 165941..166225 (+) 285 WP_201893469.1 DinI-like family protein -
  I6I42_RS18745 - 166265..167878 (-) 1614 WP_236595587.1 hypothetical protein -
  I6I42_RS00735 (I6I42_00735) - 167930..168613 (-) 684 WP_201893471.1 hypothetical protein -
  I6I42_RS00740 (I6I42_00740) - 168610..168873 (-) 264 WP_141650336.1 hypothetical protein -
  I6I42_RS00745 (I6I42_00745) - 168855..169136 (-) 282 WP_201893473.1 hypothetical protein -
  I6I42_RS00750 (I6I42_00750) - 169142..172321 (-) 3180 WP_201893475.1 host specificity protein J -
  I6I42_RS00755 (I6I42_00755) - 172354..172962 (-) 609 WP_201893477.1 tail assembly protein -
  I6I42_RS00760 (I6I42_00760) - 172975..173757 (-) 783 WP_201893479.1 KilA-N domain-containing protein -
  I6I42_RS00765 (I6I42_00765) - 173968..174309 (-) 342 WP_236595588.1 hypothetical protein -
  I6I42_RS00770 (I6I42_00770) - 174366..175073 (-) 708 WP_201893481.1 C40 family peptidase -
  I6I42_RS00775 (I6I42_00775) - 175076..175834 (-) 759 WP_201893483.1 phage minor tail protein L -
  I6I42_RS00780 (I6I42_00780) - 175831..176166 (-) 336 WP_052927722.1 phage tail protein -
  I6I42_RS00785 (I6I42_00785) - 176163..179420 (-) 3258 WP_201893485.1 phage tail tape measure protein -
  I6I42_RS00790 (I6I42_00790) - 179445..179729 (-) 285 WP_004238683.1 DUF4035 domain-containing protein -
  I6I42_RS00795 (I6I42_00795) - 179741..180124 (-) 384 WP_015422810.1 phage tail assembly chaperone -
  I6I42_RS00800 (I6I42_00800) - 180128..180595 (-) 468 WP_201893488.1 phage tail tube protein -
  I6I42_RS00805 (I6I42_00805) - 180655..180990 (-) 336 WP_201893489.1 hypothetical protein -
  I6I42_RS00810 (I6I42_00810) - 180987..181436 (-) 450 WP_201893490.1 HK97-gp10 family putative phage morphogenesis protein -
  I6I42_RS00815 (I6I42_00815) - 181429..181761 (-) 333 WP_052927728.1 phage head closure protein -
  I6I42_RS00820 (I6I42_00820) - 181758..182078 (-) 321 WP_201893491.1 head-tail connector protein -
  I6I42_RS00825 (I6I42_00825) - 182078..182368 (-) 291 WP_201894315.1 hypothetical protein -
  I6I42_RS00830 (I6I42_00830) - 182419..183633 (-) 1215 WP_052927731.1 phage major capsid protein -
  I6I42_RS00835 (I6I42_00835) - 183648..184499 (-) 852 WP_201893492.1 head maturation protease, ClpP-related -
  I6I42_RS00840 (I6I42_00840) - 184505..185842 (-) 1338 WP_052927732.1 phage portal protein -
  I6I42_RS00845 (I6I42_00845) - 185842..187572 (-) 1731 WP_201893493.1 terminase TerL endonuclease subunit -
  I6I42_RS00850 (I6I42_00850) - 187576..188046 (-) 471 WP_201893494.1 phage terminase small subunit P27 family -
  I6I42_RS00855 (I6I42_00855) - 188193..188546 (-) 354 WP_201893495.1 HNH endonuclease signature motif containing protein -
  I6I42_RS00860 (I6I42_00860) - 188676..188945 (+) 270 WP_201893497.1 hypothetical protein -
  I6I42_RS00865 (I6I42_00865) - 189007..189456 (-) 450 WP_201893499.1 lysis protein -
  I6I42_RS00870 (I6I42_00870) - 189593..190069 (-) 477 WP_201893501.1 lysozyme -
  I6I42_RS00875 (I6I42_00875) - 190062..190253 (-) 192 WP_004240322.1 phage holin family protein -
  I6I42_RS00880 (I6I42_00880) - 190482..191822 (+) 1341 WP_236595589.1 hypothetical protein -
  I6I42_RS18935 - 191839..191964 (+) 126 WP_276513080.1 hypothetical protein -
  I6I42_RS00885 (I6I42_00885) - 192093..192530 (-) 438 WP_201893503.1 antiterminator Q family protein -
  I6I42_RS00890 (I6I42_00890) - 192561..193577 (-) 1017 WP_201893505.1 DUF968 domain-containing protein -
  I6I42_RS00895 (I6I42_00895) - 193577..194362 (-) 786 WP_036409358.1 KilA-N domain-containing protein -
  I6I42_RS00900 (I6I42_00900) - 194380..194775 (-) 396 WP_036409418.1 RusA family crossover junction endodeoxyribonuclease -
  I6I42_RS00910 (I6I42_00910) - 194972..195370 (-) 399 WP_201893507.1 hypothetical protein -
  I6I42_RS00915 (I6I42_00915) - 195367..197394 (-) 2028 WP_201893508.1 phage N-6-adenine-methyltransferase -
  I6I42_RS00920 (I6I42_00920) - 197394..197636 (-) 243 WP_201893509.1 hypothetical protein -
  I6I42_RS00925 (I6I42_00925) - 197633..198517 (-) 885 WP_201893510.1 helix-turn-helix domain-containing protein -
  I6I42_RS00930 (I6I42_00930) - 198514..198702 (-) 189 WP_025155132.1 DUF4222 domain-containing protein -
  I6I42_RS00935 (I6I42_00935) - 198699..198890 (-) 192 WP_201893511.1 hypothetical protein -
  I6I42_RS00940 (I6I42_00940) - 198954..199409 (-) 456 WP_025155134.1 YmfL family putative regulatory protein -
  I6I42_RS00945 (I6I42_00945) - 199448..199693 (-) 246 WP_054424560.1 YdaS family helix-turn-helix protein -
  I6I42_RS00950 (I6I42_00950) - 199797..200483 (+) 687 WP_235557083.1 S24 family peptidase -
  I6I42_RS00955 (I6I42_00955) - 200598..200807 (+) 210 WP_054424558.1 hypothetical protein -
  I6I42_RS00960 (I6I42_00960) - 201027..201389 (+) 363 WP_108656652.1 hypothetical protein -
  I6I42_RS00965 (I6I42_00965) - 201456..202283 (+) 828 WP_201893512.1 DUF2303 family protein -
  I6I42_RS00970 (I6I42_00970) - 202393..202647 (+) 255 WP_201893518.1 pyocin activator PrtN family protein -
  I6I42_RS00975 (I6I42_00975) - 202724..204430 (-) 1707 WP_201893519.1 anti-phage dCTP deaminase -
  I6I42_RS00980 (I6I42_00980) - 204501..204695 (-) 195 WP_201893524.1 hypothetical protein -
  I6I42_RS18940 (I6I42_00985) - 204862..204984 (-) 123 WP_276513081.1 hypothetical protein -
  I6I42_RS00990 (I6I42_00990) - 205071..206252 (-) 1182 WP_201894217.1 multidrug effflux MFS transporter -
  I6I42_RS00995 (I6I42_00995) - 207013..207225 (+) 213 WP_004241538.1 helix-turn-helix transcriptional regulator -
  I6I42_RS01000 (I6I42_01000) - 207280..207633 (+) 354 WP_004241537.1 helix-turn-helix transcriptional regulator -
  I6I42_RS01005 (I6I42_01005) - 207669..208139 (-) 471 WP_024475157.1 YbaK/EbsC family protein -
  I6I42_RS01010 (I6I42_01010) zur 208316..208834 (+) 519 WP_024475156.1 zinc uptake transcriptional repressor Zur -
  I6I42_RS01015 (I6I42_01015) lexA 208913..209527 (-) 615 WP_004238270.1 transcriptional repressor LexA -

Sequence


Protein


Download         Length: 173 a.a.        Molecular weight: 18770.82 Da        Isoelectric Point: 4.9567

>NTDB_id=527523 I6I42_RS00665 WP_004238253.1 151384..151905(-) (ssb) [Morganella morganii strain FDAARGOS_1085]
MASRGVNKVILIGNLGQDPEVRYMPNGGAVTNITLATSESWRDKQTGEMKEKTEWHRVVIFGKLAEIAGEYLKKGSQVYI
EGSLQTRKWQDQSGQERYTTEVVVNIGGSMQMLGGRSGGGDNMSQGGGWGQPQQPQQSQQFSGGGNPRPAQQPAAAAPQS
NEPPMDFDDDIPF

Nucleotide


Download         Length: 522 bp        

>NTDB_id=527523 I6I42_RS00665 WP_004238253.1 151384..151905(-) (ssb) [Morganella morganii strain FDAARGOS_1085]
ATGGCCAGCAGAGGCGTCAACAAAGTCATTCTTATCGGGAACCTGGGTCAGGATCCGGAAGTGCGTTACATGCCTAACGG
CGGTGCGGTTACCAACATCACACTGGCGACATCAGAATCATGGCGTGATAAACAAACCGGCGAAATGAAAGAGAAGACCG
AATGGCACCGTGTGGTGATCTTCGGCAAACTGGCAGAAATTGCCGGTGAATATCTGAAAAAAGGTTCACAGGTTTATATC
GAAGGTTCACTCCAGACCCGCAAATGGCAGGATCAGAGCGGCCAGGAGCGTTACACCACGGAAGTCGTGGTGAATATCGG
CGGCAGCATGCAGATGCTGGGCGGCCGCAGCGGCGGTGGCGACAATATGTCTCAGGGCGGCGGCTGGGGTCAGCCACAGC
AGCCACAACAATCCCAGCAGTTCAGCGGCGGCGGCAACCCGCGCCCGGCACAGCAGCCGGCAGCAGCAGCGCCGCAAAGC
AATGAACCGCCAATGGATTTTGATGACGATATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB J7TBA8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

69.73

100

0.746

  ssb Glaesserella parasuis strain SC1401

57.297

100

0.613

  ssb Neisseria meningitidis MC58

48.864

100

0.497

  ssb Neisseria gonorrhoeae MS11

48.864

100

0.497