Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I8E17_RS00755 | Genome accession | NZ_CP067071 |
| Coordinates | 143332..143838 (-) | Length | 168 a.a. |
| NCBI ID | WP_219511049.1 | Uniprot ID | - |
| Organism | Rhizobium sp. AB2/73 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 124491..166137 | 143332..143838 | within | 0 |
Gene organization within MGE regions
Location: 124491..166137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I8E17_RS00650 (I8E17_00650) | - | 124491..125525 (+) | 1035 | WP_069611235.1 | substrate-binding domain-containing protein | - |
| I8E17_RS00655 (I8E17_00655) | pstC | 125588..127069 (+) | 1482 | WP_113367274.1 | phosphate ABC transporter permease subunit PstC | - |
| I8E17_RS00660 (I8E17_00660) | pstA | 127099..128400 (+) | 1302 | WP_113367285.1 | phosphate ABC transporter permease PstA | - |
| I8E17_RS00665 (I8E17_00665) | pstB | 128416..129231 (+) | 816 | WP_069611238.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| I8E17_RS00670 (I8E17_00670) | phoU | 129283..129996 (+) | 714 | WP_015338719.1 | phosphate signaling complex protein PhoU | - |
| I8E17_RS00675 (I8E17_00675) | phoB | 130028..130711 (+) | 684 | WP_004128368.1 | phosphate regulon transcriptional regulator PhoB | - |
| I8E17_RS00680 (I8E17_00680) | - | 130902..131429 (-) | 528 | WP_069611239.1 | GcrA family cell cycle regulator | - |
| I8E17_RS00685 (I8E17_00685) | - | 131855..133054 (+) | 1200 | WP_069611240.1 | aspartate aminotransferase family protein | - |
| I8E17_RS00690 (I8E17_00690) | argF | 133224..134141 (+) | 918 | WP_069611241.1 | ornithine carbamoyltransferase | - |
| I8E17_RS00695 (I8E17_00695) | - | 134190..135179 (+) | 990 | WP_069611242.1 | Hsp33 family molecular chaperone | - |
| I8E17_RS00700 (I8E17_00700) | apaG | 135198..135590 (-) | 393 | WP_069611387.1 | Co2+/Mg2+ efflux protein ApaG | - |
| I8E17_RS00705 (I8E17_00705) | - | 136204..136917 (+) | 714 | WP_069611243.1 | DNA helicase | - |
| I8E17_RS00710 (I8E17_00710) | - | 136984..138171 (-) | 1188 | WP_069611244.1 | O-succinylhomoserine sulfhydrylase | - |
| I8E17_RS00715 (I8E17_00715) | - | 138366..139460 (+) | 1095 | WP_069611245.1 | 2'-deoxycytidine 5'-triphosphate deaminase | - |
| I8E17_RS00725 (I8E17_00725) | - | 139673..140722 (-) | 1050 | WP_219511061.1 | tyrosine-type recombinase/integrase | - |
| I8E17_RS00730 (I8E17_00730) | - | 140703..140909 (-) | 207 | WP_219511058.1 | hypothetical protein | - |
| I8E17_RS00735 (I8E17_00735) | - | 140911..141279 (-) | 369 | WP_219511057.1 | HNH endonuclease signature motif containing protein | - |
| I8E17_RS00740 (I8E17_00740) | - | 141279..141728 (-) | 450 | WP_219511055.1 | hypothetical protein | - |
| I8E17_RS00745 (I8E17_00745) | dnaN | 141828..142967 (-) | 1140 | WP_219511053.1 | DNA polymerase III subunit beta | - |
| I8E17_RS00750 (I8E17_00750) | - | 142958..143323 (-) | 366 | WP_219511051.1 | hypothetical protein | - |
| I8E17_RS00755 (I8E17_00755) | ssb | 143332..143838 (-) | 507 | WP_219511049.1 | single-stranded DNA-binding protein | Machinery gene |
| I8E17_RS00760 (I8E17_00760) | - | 143838..144191 (-) | 354 | WP_219511046.1 | hypothetical protein | - |
| I8E17_RS00765 (I8E17_00765) | - | 144192..144863 (-) | 672 | WP_219511044.1 | hypothetical protein | - |
| I8E17_RS00770 (I8E17_00770) | - | 144860..145036 (-) | 177 | WP_219511042.1 | hypothetical protein | - |
| I8E17_RS00775 (I8E17_00775) | - | 145046..145279 (-) | 234 | WP_219511040.1 | hypothetical protein | - |
| I8E17_RS00780 (I8E17_00780) | - | 145691..146383 (-) | 693 | WP_219511457.1 | helix-turn-helix transcriptional regulator | - |
| I8E17_RS00785 (I8E17_00785) | - | 146466..146672 (+) | 207 | WP_112605555.1 | Cro/CI family transcriptional regulator | - |
| I8E17_RS00790 (I8E17_00790) | - | 146792..147262 (+) | 471 | WP_229002060.1 | phage regulatory CII family protein | - |
| I8E17_RS00795 (I8E17_00795) | - | 147259..147528 (+) | 270 | WP_219511036.1 | hypothetical protein | - |
| I8E17_RS00800 (I8E17_00800) | - | 147525..148184 (+) | 660 | WP_219511035.1 | GcrA family cell cycle regulator | - |
| I8E17_RS00805 (I8E17_00805) | - | 148184..149572 (+) | 1389 | WP_219511032.1 | helicase | - |
| I8E17_RS00810 (I8E17_00810) | - | 149569..150588 (+) | 1020 | WP_219511029.1 | DNA methyltransferase | - |
| I8E17_RS00815 (I8E17_00815) | - | 150581..150976 (+) | 396 | WP_219511027.1 | hypothetical protein | - |
| I8E17_RS00820 (I8E17_00820) | - | 150976..151311 (+) | 336 | WP_219511024.1 | hypothetical protein | - |
| I8E17_RS00825 | - | 151458..151814 (-) | 357 | WP_229002061.1 | hypothetical protein | - |
| I8E17_RS00830 (I8E17_00830) | - | 152405..153652 (+) | 1248 | WP_219511020.1 | primase-helicase zinc-binding domain-containing protein | - |
| I8E17_RS00835 (I8E17_00835) | - | 153653..155425 (+) | 1773 | WP_113397437.1 | phage/plasmid primase, P4 family | - |
| I8E17_RS00840 (I8E17_00840) | - | 155817..156635 (+) | 819 | WP_219511018.1 | hypothetical protein | - |
| I8E17_RS00845 (I8E17_00845) | - | 156756..157136 (+) | 381 | WP_219511015.1 | HNH endonuclease signature motif containing protein | - |
| I8E17_RS00850 (I8E17_00850) | - | 157138..157392 (+) | 255 | WP_219511014.1 | hypothetical protein | - |
| I8E17_RS00855 (I8E17_00855) | - | 157625..158029 (+) | 405 | WP_219511012.1 | hypothetical protein | - |
| I8E17_RS00860 (I8E17_00860) | - | 158174..158626 (+) | 453 | WP_219511011.1 | phage tail tube protein | - |
| I8E17_RS00865 (I8E17_00865) | - | 158626..159030 (+) | 405 | WP_219511010.1 | gene transfer agent family protein | - |
| I8E17_RS35265 | - | 159051..159173 (+) | 123 | WP_257714001.1 | hypothetical protein | - |
| I8E17_RS00870 (I8E17_00870) | - | 159213..161078 (+) | 1866 | WP_219511009.1 | tape measure protein | - |
| I8E17_RS00875 (I8E17_00875) | - | 161114..164428 (+) | 3315 | WP_219511007.1 | hypothetical protein | - |
| I8E17_RS00880 (I8E17_00880) | - | 164466..165098 (+) | 633 | WP_219511006.1 | hypothetical protein | - |
| I8E17_RS00885 (I8E17_00885) | - | 165098..165388 (+) | 291 | WP_219511005.1 | hypothetical protein | - |
| I8E17_RS00890 (I8E17_00890) | - | 165385..165813 (+) | 429 | WP_229002062.1 | hypothetical protein | - |
| I8E17_RS00895 (I8E17_00895) | - | 165779..166045 (+) | 267 | WP_229002063.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18760.70 Da Isoelectric Point: 5.9684
>NTDB_id=524834 I8E17_RS00755 WP_219511049.1 143332..143838(-) (ssb) [Rhizobium sp. AB2/73]
MAGYLNKVTLIGNLGADPEIRRTQDGRPIANLNLATAEQWRDKNTGERKERTEWHRIVIFNEQLAKIAEQFLEKGAKIYI
EGQLATRKWQDQNGQDRWSTEIVLQGFDAKLIMLNKKDGSGYRQGGNGAGDYGYDSDRAAGSSSSSSTRTSQTIGGNFSR
DLDDDIPF
MAGYLNKVTLIGNLGADPEIRRTQDGRPIANLNLATAEQWRDKNTGERKERTEWHRIVIFNEQLAKIAEQFLEKGAKIYI
EGQLATRKWQDQNGQDRWSTEIVLQGFDAKLIMLNKKDGSGYRQGGNGAGDYGYDSDRAAGSSSSSSTRTSQTIGGNFSR
DLDDDIPF
Nucleotide
Download Length: 507 bp
>NTDB_id=524834 I8E17_RS00755 WP_219511049.1 143332..143838(-) (ssb) [Rhizobium sp. AB2/73]
ATGGCGGGATATCTCAACAAGGTCACGCTGATCGGCAATCTCGGCGCCGATCCGGAAATCCGCCGCACGCAGGATGGCCG
GCCCATTGCCAATCTCAACCTCGCCACGGCAGAGCAATGGCGCGACAAGAATACCGGTGAGCGCAAAGAGCGAACCGAGT
GGCACCGCATCGTCATCTTCAACGAGCAGCTGGCGAAGATCGCCGAGCAGTTCCTTGAGAAGGGCGCCAAGATCTACATC
GAGGGCCAGCTCGCCACCCGAAAATGGCAGGACCAGAACGGGCAGGACCGGTGGAGCACGGAAATCGTGCTGCAGGGCTT
CGATGCCAAGTTGATCATGCTGAACAAGAAGGACGGCTCCGGCTATCGCCAGGGCGGCAATGGCGCTGGCGACTATGGCT
ATGACAGCGACCGCGCCGCCGGCTCGTCCTCTTCATCCTCCACCCGAACATCGCAGACGATCGGCGGCAATTTCAGCCGC
GACCTCGACGATGACATTCCGTTCTGA
ATGGCGGGATATCTCAACAAGGTCACGCTGATCGGCAATCTCGGCGCCGATCCGGAAATCCGCCGCACGCAGGATGGCCG
GCCCATTGCCAATCTCAACCTCGCCACGGCAGAGCAATGGCGCGACAAGAATACCGGTGAGCGCAAAGAGCGAACCGAGT
GGCACCGCATCGTCATCTTCAACGAGCAGCTGGCGAAGATCGCCGAGCAGTTCCTTGAGAAGGGCGCCAAGATCTACATC
GAGGGCCAGCTCGCCACCCGAAAATGGCAGGACCAGAACGGGCAGGACCGGTGGAGCACGGAAATCGTGCTGCAGGGCTT
CGATGCCAAGTTGATCATGCTGAACAAGAAGGACGGCTCCGGCTATCGCCAGGGCGGCAATGGCGCTGGCGACTATGGCT
ATGACAGCGACCGCGCCGCCGGCTCGTCCTCTTCATCCTCCACCCGAACATCGCAGACGATCGGCGGCAATTTCAGCCGC
GACCTCGACGATGACATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
43.915 |
100 |
0.494 |
| ssb | Vibrio cholerae strain A1552 |
46.821 |
100 |
0.482 |
| ssb | Neisseria meningitidis MC58 |
37.079 |
100 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
37.079 |
100 |
0.393 |