Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JGE02_RS05265 Genome accession   NZ_CP067042
Coordinates   1075680..1076165 (+) Length   161 a.a.
NCBI ID   WP_005711354.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain B6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1066310..1105867 1075680..1076165 within 0


Gene organization within MGE regions


Location: 1066310..1105867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JGE02_RS05185 (JGE02_05180) - 1066310..1067494 (-) 1185 WP_005714751.1 tyrosine-type recombinase/integrase -
  JGE02_RS05195 (JGE02_05185) - 1067839..1068840 (-) 1002 WP_005714749.1 hypothetical protein -
  JGE02_RS05200 (JGE02_05190) - 1068954..1069544 (-) 591 WP_020751902.1 DUF5067 domain-containing protein -
  JGE02_RS05205 (JGE02_05195) - 1069604..1070026 (-) 423 WP_003594164.1 ImmA/IrrE family metallo-endopeptidase -
  JGE02_RS05210 (JGE02_05200) - 1070016..1070351 (-) 336 WP_005714743.1 helix-turn-helix domain-containing protein -
  JGE02_RS05215 (JGE02_05205) - 1070489..1070731 (+) 243 WP_005711333.1 helix-turn-helix domain-containing protein -
  JGE02_RS05220 (JGE02_05210) - 1070728..1070886 (+) 159 WP_005711335.1 hypothetical protein -
  JGE02_RS05225 (JGE02_05215) - 1070904..1071635 (+) 732 WP_005711337.1 antA/AntB antirepressor family protein -
  JGE02_RS05230 (JGE02_05220) - 1071701..1072249 (+) 549 WP_005714742.1 hypothetical protein -
  JGE02_RS05235 (JGE02_05225) - 1072228..1072458 (+) 231 WP_005711341.1 hypothetical protein -
  JGE02_RS13890 - 1072462..1072590 (+) 129 WP_005711343.1 hypothetical protein -
  JGE02_RS05240 (JGE02_05230) - 1072602..1072829 (+) 228 WP_005711345.1 hypothetical protein -
  JGE02_RS05245 (JGE02_05235) - 1072822..1073025 (+) 204 WP_005711347.1 hypothetical protein -
  JGE02_RS05250 (JGE02_05240) - 1073036..1073911 (+) 876 WP_005711348.1 recombinase RecT -
  JGE02_RS05255 (JGE02_05245) - 1073847..1074695 (+) 849 WP_286011666.1 PD-(D/E)XK nuclease-like domain-containing protein -
  JGE02_RS05260 (JGE02_05250) - 1074711..1075667 (+) 957 WP_005711352.1 DnaD domain-containing protein -
  JGE02_RS05265 (JGE02_05255) ssb 1075680..1076165 (+) 486 WP_005711354.1 single-stranded DNA-binding protein Machinery gene
  JGE02_RS05270 (JGE02_05260) - 1076473..1076688 (+) 216 WP_005711356.1 helix-turn-helix domain-containing protein -
  JGE02_RS05275 (JGE02_05265) - 1076685..1077134 (+) 450 WP_005711359.1 hypothetical protein -
  JGE02_RS05280 (JGE02_05270) - 1077181..1077435 (+) 255 WP_005711361.1 hypothetical protein -
  JGE02_RS05285 (JGE02_05275) - 1077432..1077797 (+) 366 WP_005714739.1 hypothetical protein -
  JGE02_RS05290 (JGE02_05280) - 1077810..1078274 (+) 465 WP_005711364.1 hypothetical protein -
  JGE02_RS13825 - 1078286..1078537 (+) 252 WP_005711366.1 hypothetical protein -
  JGE02_RS05295 (JGE02_05285) - 1078657..1079163 (+) 507 WP_005711368.1 DUF1642 domain-containing protein -
  JGE02_RS05300 (JGE02_05290) - 1079153..1079503 (+) 351 WP_005711370.1 hypothetical protein -
  JGE02_RS13920 - 1079500..1079708 (+) 209 Protein_1018 hypothetical protein -
  JGE02_RS05305 (JGE02_05295) - 1079836..1080057 (+) 222 WP_005711376.1 helix-turn-helix domain-containing protein -
  JGE02_RS05310 (JGE02_05300) - 1080266..1080694 (+) 429 WP_005711378.1 hypothetical protein -
  JGE02_RS05315 (JGE02_05305) - 1081027..1081887 (+) 861 WP_005711380.1 hypothetical protein -
  JGE02_RS05320 (JGE02_05310) - 1082428..1083576 (+) 1149 WP_005711382.1 GcrA family cell cycle regulator -
  JGE02_RS05325 (JGE02_05315) - 1083569..1083892 (+) 324 WP_005711383.1 hypothetical protein -
  JGE02_RS05330 (JGE02_05320) - 1083929..1084462 (+) 534 WP_005711385.1 terminase small subunit -
  JGE02_RS05335 (JGE02_05325) - 1084440..1085795 (+) 1356 WP_005714737.1 PBSX family phage terminase large subunit -
  JGE02_RS05340 (JGE02_05330) - 1085800..1087188 (+) 1389 WP_005711389.1 phage portal protein -
  JGE02_RS05345 (JGE02_05335) - 1087311..1088933 (+) 1623 WP_238397388.1 minor capsid protein -
  JGE02_RS05350 (JGE02_05340) - 1089082..1089738 (+) 657 WP_005711393.1 DUF4355 domain-containing protein -
  JGE02_RS05355 (JGE02_05345) - 1089754..1090767 (+) 1014 WP_005711395.1 hypothetical protein -
  JGE02_RS05360 (JGE02_05350) - 1090995..1091369 (+) 375 WP_005711397.1 phage head-tail connector protein -
  JGE02_RS05365 (JGE02_05355) - 1091374..1091676 (+) 303 WP_005711399.1 hypothetical protein -
  JGE02_RS05370 (JGE02_05360) - 1091673..1092038 (+) 366 WP_005711401.1 HK97-gp10 family putative phage morphogenesis protein -
  JGE02_RS05375 (JGE02_05365) - 1092039..1092443 (+) 405 WP_003582636.1 DUF3168 domain-containing protein -
  JGE02_RS05380 (JGE02_05370) - 1092455..1093060 (+) 606 WP_005711403.1 phage tail tube protein -
  JGE02_RS05385 (JGE02_05375) - 1093147..1093479 (+) 333 WP_005711405.1 tail assembly chaperone -
  JGE02_RS05390 (JGE02_05380) - 1093584..1093937 (+) 354 WP_005711407.1 hypothetical protein -
  JGE02_RS05395 (JGE02_05385) - 1093930..1097019 (+) 3090 WP_005711409.1 tape measure protein -
  JGE02_RS05400 (JGE02_05390) - 1097020..1099008 (+) 1989 WP_005714730.1 distal tail protein Dit -
  JGE02_RS05405 (JGE02_05395) - 1099009..1101444 (+) 2436 WP_020751906.1 phage tail protein -
  JGE02_RS05410 (JGE02_05400) - 1101446..1101736 (+) 291 WP_005713395.1 hypothetical protein -
  JGE02_RS13830 - 1101729..1101860 (+) 132 WP_005714777.1 XkdX family protein -
  JGE02_RS05415 (JGE02_05405) - 1101890..1102180 (+) 291 WP_005714776.1 hypothetical protein -
  JGE02_RS05420 (JGE02_05410) - 1102173..1102619 (+) 447 WP_005714775.1 phage holin -
  JGE02_RS05425 (JGE02_05415) - 1102630..1103814 (+) 1185 WP_005713391.1 GH25 family lysozyme -
  JGE02_RS13935 - 1104012..1104086 (+) 75 Protein_1045 glucose-6-phosphate isomerase -
  JGE02_RS05430 (JGE02_05420) - 1104434..1104721 (-) 288 WP_005713389.1 putative quinol monooxygenase -
  JGE02_RS05435 (JGE02_05425) - 1105016..1105867 (-) 852 WP_005713388.1 DNA/RNA non-specific endonuclease -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 17645.39 Da        Isoelectric Point: 7.9701

>NTDB_id=524580 JGE02_RS05265 WP_005711354.1 1075680..1076165(+) (ssb) [Lacticaseibacillus rhamnosus strain B6]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQTSQNSPKSQQTVNASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=524580 JGE02_RS05265 WP_005711354.1 1075680..1076165(+) (ssb) [Lacticaseibacillus rhamnosus strain B6]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGTCCTAAATCACAGCAAACAGTCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.791

100

0.671

  ssbA Bacillus subtilis subsp. subtilis str. 168

49.419

100

0.528

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

65.839

0.36

  ssb Neisseria meningitidis MC58

33.526

100

0.36