Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   JG797_RS25870 Genome accession   NZ_CP066915
Coordinates   5195462..5195989 (-) Length   175 a.a.
NCBI ID   WP_000290834.1    Uniprot ID   A0A5C2D111
Organism   Klebsiella pneumoniae strain XHKPN391     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5174921..5228268 5195462..5195989 within 0


Gene organization within MGE regions


Location: 5174921..5228268
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JG797_RS25750 nfuA 5174921..5175496 (+) 576 WP_002920540.1 Fe-S biogenesis protein NfuA -
  JG797_RS25755 gntT 5175833..5177149 (+) 1317 WP_002920542.1 gluconate transporter -
  JG797_RS25760 malQ 5177252..5179345 (-) 2094 WP_002920543.1 4-alpha-glucanotransferase -
  JG797_RS25765 malP 5179356..5181746 (-) 2391 WP_004151407.1 maltodextrin phosphorylase -
  JG797_RS28905 - 5182214..5182474 (-) 261 WP_306459082.1 hypothetical protein -
  JG797_RS25770 - 5182456..5183436 (-) 981 WP_255211911.1 IS5-like element ISKpn26 family transposase -
  JG797_RS25775 - 5183484..5184188 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  JG797_RS25780 - 5184254..5184457 (-) 204 Protein_5088 conjugal transfer protein TraB -
  JG797_RS25785 traK 5184457..5185185 (-) 729 WP_001230787.1 type-F conjugative transfer system secretin TraK -
  JG797_RS25790 traE 5185172..5185738 (-) 567 WP_000399794.1 type IV conjugative transfer system protein TraE -
  JG797_RS25795 traL 5185760..5186071 (-) 312 WP_000012106.1 type IV conjugative transfer system protein TraL -
  JG797_RS25800 traA 5186086..5186451 (-) 366 WP_021519752.1 type IV conjugative transfer system pilin TraA -
  JG797_RS25805 traY 5186485..5186712 (-) 228 WP_001254386.1 conjugal transfer relaxosome protein TraY -
  JG797_RS25810 - 5186806..5187492 (-) 687 WP_015059009.1 PAS domain-containing protein -
  JG797_RS25815 traM 5187683..5188066 (-) 384 WP_000124981.1 conjugal transfer relaxosome DNA-binding protein TraM -
  JG797_RS25820 - 5188343..5188990 (+) 648 WP_015059008.1 transglycosylase SLT domain-containing protein -
  JG797_RS25825 - 5189287..5190108 (-) 822 WP_001234445.1 DUF932 domain-containing protein -
  JG797_RS25830 - 5190219..5190515 (-) 297 WP_001272251.1 hypothetical protein -
  JG797_RS25835 - 5190815..5191111 (+) 297 Protein_5099 hypothetical protein -
  JG797_RS25840 - 5191430..5191555 (-) 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin -
  JG797_RS25845 mok 5191497..5191646 (-) 150 Protein_5101 plasmid maintenance protein Mok -
  JG797_RS25850 - 5191868..5192587 (-) 720 WP_001276217.1 plasmid SOS inhibition protein A -
  JG797_RS25855 psiB 5192584..5193018 (-) 435 WP_000845953.1 conjugation system SOS inhibitor PsiB -
  JG797_RS25860 - 5193087..5195110 (-) 2024 Protein_5104 ParB/RepB/Spo0J family partition protein -
  JG797_RS25865 - 5195171..5195404 (-) 234 WP_000006003.1 DUF905 family protein -
  JG797_RS25870 ssb 5195462..5195989 (-) 528 WP_000290834.1 single-stranded DNA-binding protein Machinery gene
  JG797_RS25875 - 5196291..5196752 (+) 462 Protein_5107 hypothetical protein -
  JG797_RS25880 - 5196838..5197401 (-) 564 WP_015059007.1 trans-aconitate 2-methyltransferase -
  JG797_RS25885 - 5197448..5198809 (-) 1362 WP_000170695.1 DUF3560 domain-containing protein -
  JG797_RS25890 - 5198861..5199091 (-) 231 WP_000218642.1 hypothetical protein -
  JG797_RS25895 - 5199608..5199762 (+) 155 Protein_5111 hypothetical protein -
  JG797_RS25900 ltrA 5200491..5202158 (+) 1668 WP_012372796.1 group II intron reverse transcriptase/maturase -
  JG797_RS25905 - 5202472..5202663 (-) 192 WP_001027493.1 hypothetical protein -
  JG797_RS25910 - 5202660..5203082 (-) 423 WP_000271762.1 DUF1380 family protein -
  JG797_RS25915 - 5203129..5203554 (-) 426 WP_001198928.1 antirestriction protein -
  JG797_RS25920 - 5203972..5204748 (-) 777 WP_001383963.1 hypothetical protein -
  JG797_RS25925 - 5204799..5205233 (-) 435 WP_000274503.1 DUF1380 family protein -
  JG797_RS25930 - 5205247..5205468 (-) 222 WP_001104881.1 hypothetical protein -
  JG797_RS25935 - 5205469..5206152 (-) 684 WP_000085883.1 DNA methylase -
  JG797_RS25940 - 5206229..5206456 (-) 228 WP_170942586.1 hypothetical protein -
  JG797_RS28910 - 5206357..5206563 (+) 207 WP_306173356.1 hypothetical protein -
  JG797_RS25945 parM 5206669..5207631 (+) 963 WP_000959884.1 plasmid segregation protein ParM -
  JG797_RS25950 - 5207634..5207984 (+) 351 WP_000361389.1 plasmid partitioning/stability family protein -
  JG797_RS25955 - 5208107..5208388 (-) 282 WP_001333089.1 hypothetical protein -
  JG797_RS25960 - 5208516..5208750 (-) 235 Protein_5125 type II toxin-antitoxin system RelE/ParE family toxin -
  JG797_RS28915 - 5210199..5210339 (-) 141 WP_071557810.1 IS1 family transposase -
  JG797_RS25965 - 5210330..5211034 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  JG797_RS25970 - 5211122..5211403 (+) 282 WP_015059004.1 sodium/hydrogen exchanger -
  JG797_RS25975 - 5211484..5212239 (-) 756 WP_012372818.1 16S rRNA (guanine(1405)-N(7))-methyltransferase RmtB1 -
  JG797_RS25980 - 5212409..5213269 (-) 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
  JG797_RS25985 - 5213452..5213988 (-) 537 WP_064441864.1 recombinase family protein -
  JG797_RS25990 - 5214080..5214268 (+) 189 WP_000957857.1 hypothetical protein -
  JG797_RS25995 - 5214278..5214895 (+) 618 Protein_5133 transposase zinc-binding domain-containing protein -
  JG797_RS26000 - 5214946..5215650 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  JG797_RS26005 - 5215808..5216086 (+) 279 WP_013213990.1 hypothetical protein -
  JG797_RS26010 - 5216197..5216622 (+) 426 WP_013213989.1 antirestriction protein -
  JG797_RS26015 - 5216750..5216905 (+) 156 WP_013213988.1 hypothetical protein -
  JG797_RS26020 - 5216951..5217247 (+) 297 WP_013213987.1 transcriptional regulator -
  JG797_RS26025 - 5217351..5218232 (+) 882 Protein_5139 IS1182-like element ISKpn6 family transposase -
  JG797_RS26030 - 5218482..5219363 (-) 882 WP_004199234.1 carbapenem-hydrolyzing class A beta-lactamase KPC-2 -
  JG797_RS26035 - 5219639..5220619 (-) 981 WP_013213985.1 IS481-like element ISKpn27 family transposase -
  JG797_RS26040 - 5220742..5221203 (-) 462 Protein_5142 recombinase family protein -
  JG797_RS26045 - 5221255..5221959 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  JG797_RS26050 - 5222117..5222395 (+) 279 WP_013213990.1 hypothetical protein -
  JG797_RS26055 - 5222506..5222931 (+) 426 WP_013213989.1 antirestriction protein -
  JG797_RS26060 - 5223059..5223214 (+) 156 WP_013213988.1 hypothetical protein -
  JG797_RS26065 - 5223260..5223556 (+) 297 WP_013213987.1 transcriptional regulator -
  JG797_RS26070 - 5223660..5224541 (+) 882 Protein_5148 IS1182-like element ISKpn6 family transposase -
  JG797_RS26075 - 5224791..5225672 (-) 882 WP_004199234.1 carbapenem-hydrolyzing class A beta-lactamase KPC-2 -
  JG797_RS26080 - 5225948..5226928 (-) 981 WP_013213985.1 IS481-like element ISKpn27 family transposase -
  JG797_RS26085 - 5227051..5227512 (-) 462 Protein_5151 recombinase family protein -
  JG797_RS26090 - 5227564..5228268 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19296.68 Da        Isoelectric Point: 9.6216

>NTDB_id=523151 JG797_RS25870 WP_000290834.1 5195462..5195989(-) (ssb) [Klebsiella pneumoniae strain XHKPN391]
MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYI
EGQLRTRSWEDNGITRYVTEILVKTTGTMQMLGSAPQQNAQVQPQPQQNGQSQSADATKKGSAKTKGRGRKAAQPEPQPQ
PPEGEDYGFSDDIPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=523151 JG797_RS25870 WP_000290834.1 5195462..5195989(-) (ssb) [Klebsiella pneumoniae strain XHKPN391]
ATGGCAGTTCGTGGCATTAACAAGGTCATTCTTGTCGGTCGTCTGGGAAAAGATCCGGAAGTCCGTTACATCCCCAACGG
GGGCGCAGTGGCAAACCTGCAGGTGGCCACGTCAGAAACCTGGCGCGACAAACAGACGGGGGAAATGAAGGAGCAGACGG
AATGGCACCGCGTGGTGCTGTTCGGCAAGCTCGCGGAAGTGGCAGGTGAATATCTGCGTAAGGGGGCGCAGGTCTACATT
GAAGGCCAGCTTCGCACCCGTAGCTGGGAAGATAACGGTATTACCCGTTACGTCACCGAAATCCTTGTTAAAACCACGGG
CACCATGCAGATGCTGGGGAGTGCACCACAGCAGAACGCTCAGGTGCAACCGCAGCCTCAGCAGAATGGTCAGTCACAGA
GTGCTGACGCGACGAAAAAAGGGAGCGCGAAAACGAAAGGCCGTGGACGTAAGGCTGCGCAGCCGGAGCCTCAGCCGCAA
CCACCGGAGGGGGAGGATTACGGGTTTTCAGACGATATCCCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-110)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5C2D111

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

56.354

100

0.583
  ssb Glaesserella parasuis strain SC1401

46.196

100

0.486
  ssb Neisseria meningitidis MC58

41.899

100

0.429
  ssb Neisseria gonorrhoeae MS11

41.899

100

0.429