Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I6H64_RS04150 Genome accession   NZ_CP066046
Coordinates   845574..846050 (-) Length   158 a.a.
NCBI ID   WP_008840867.1    Uniprot ID   A0AAW8YED4
Organism   Pediococcus acidilactici strain FDAARGOS_1007     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 836381..873406 845574..846050 within 0


Gene organization within MGE regions


Location: 836381..873406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6H64_RS04085 (I6H64_04085) - 836381..836602 (-) 222 WP_002831526.1 YneF family protein -
  I6H64_RS04090 (I6H64_04090) - 836672..836920 (-) 249 WP_008840877.1 DUF896 domain-containing protein -
  I6H64_RS04095 (I6H64_04095) lexA 837027..837656 (+) 630 WP_002831524.1 transcriptional repressor LexA -
  I6H64_RS04100 (I6H64_04100) - 837737..838345 (+) 609 WP_008840876.1 hypothetical protein -
  I6H64_RS04105 (I6H64_04105) - 838447..839616 (-) 1170 WP_036685030.1 hydroxymethylglutaryl-CoA synthase -
  I6H64_RS04110 (I6H64_04110) - 839950..841248 (-) 1299 WP_008840874.1 PBSX family phage terminase large subunit -
  I6H64_RS10105 - 841245..841556 (-) 312 WP_008840873.1 hypothetical protein -
  I6H64_RS10110 - 841570..841917 (-) 348 WP_052017554.1 helix-turn-helix domain-containing protein -
  I6H64_RS04120 (I6H64_04120) - 841970..842743 (-) 774 WP_144235475.1 DUF805 domain-containing protein -
  I6H64_RS04125 (I6H64_04125) - 842930..843715 (-) 786 WP_232623516.1 abortive infection family protein -
  I6H64_RS04135 (I6H64_04135) - 844678..844914 (-) 237 WP_008840869.1 hypothetical protein -
  I6H64_RS04140 (I6H64_04140) - 844907..845143 (-) 237 WP_036685021.1 hypothetical protein -
  I6H64_RS04145 (I6H64_04145) - 845257..845562 (-) 306 WP_036685019.1 helix-turn-helix domain-containing protein -
  I6H64_RS04150 (I6H64_04150) ssb 845574..846050 (-) 477 WP_008840867.1 single-stranded DNA-binding protein Machinery gene
  I6H64_RS04155 (I6H64_04155) - 846043..846252 (-) 210 WP_008840866.1 hypothetical protein -
  I6H64_RS04160 (I6H64_04160) - 846294..846467 (-) 174 WP_219938577.1 helix-turn-helix domain-containing protein -
  I6H64_RS04165 (I6H64_04165) - 846545..846952 (-) 408 WP_036685016.1 hypothetical protein -
  I6H64_RS04170 (I6H64_04170) - 846936..847619 (-) 684 WP_008840863.1 putative HNHc nuclease -
  I6H64_RS04175 (I6H64_04175) - 847646..848110 (-) 465 WP_008840862.1 hypothetical protein -
  I6H64_RS04180 (I6H64_04180) - 848122..849003 (-) 882 WP_052017552.1 PD-(D/E)XK nuclease-like domain-containing protein -
  I6H64_RS04185 (I6H64_04185) bet 848912..849709 (-) 798 WP_008840860.1 phage recombination protein Bet -
  I6H64_RS04190 (I6H64_04190) - 849702..849947 (-) 246 WP_008840859.1 hypothetical protein -
  I6H64_RS04195 (I6H64_04195) - 850040..850183 (-) 144 WP_158002712.1 hypothetical protein -
  I6H64_RS04200 (I6H64_04200) - 850185..850466 (-) 282 WP_008840858.1 hypothetical protein -
  I6H64_RS04205 (I6H64_04205) - 850467..850931 (-) 465 WP_232623517.1 helix-turn-helix domain-containing protein -
  I6H64_RS04210 (I6H64_04210) - 851016..851231 (-) 216 WP_036685013.1 hypothetical protein -
  I6H64_RS04215 (I6H64_04215) - 851300..851497 (+) 198 WP_036685010.1 hypothetical protein -
  I6H64_RS04220 (I6H64_04220) - 851489..851857 (-) 369 WP_036685008.1 hypothetical protein -
  I6H64_RS04225 (I6H64_04225) - 851889..852026 (-) 138 WP_008840855.1 hypothetical protein -
  I6H64_RS04230 (I6H64_04230) - 852023..852253 (-) 231 WP_008840854.1 helix-turn-helix transcriptional regulator -
  I6H64_RS04235 (I6H64_04235) - 852396..852758 (+) 363 WP_008840853.1 helix-turn-helix domain-containing protein -
  I6H64_RS04240 (I6H64_04240) - 852770..853177 (+) 408 WP_036685006.1 ImmA/IrrE family metallo-endopeptidase -
  I6H64_RS04245 (I6H64_04245) - 853246..854010 (+) 765 WP_008840851.1 DUF4352 domain-containing protein -
  I6H64_RS04250 (I6H64_04250) - 854322..854984 (+) 663 WP_056984994.1 ATP-binding protein -
  I6H64_RS04255 (I6H64_04255) - 855014..855349 (+) 336 WP_008842112.1 STAS-like domain-containing protein -
  I6H64_RS04260 (I6H64_04260) - 855342..855869 (+) 528 WP_008842113.1 PIN domain-containing protein -
  I6H64_RS04265 (I6H64_04265) - 855951..856220 (+) 270 WP_008842114.1 hypothetical protein -
  I6H64_RS04270 (I6H64_04270) - 856308..857483 (+) 1176 WP_008842115.1 tyrosine-type recombinase/integrase -
  I6H64_RS04275 (I6H64_04275) fabI 857611..858369 (-) 759 WP_008842116.1 enoyl-ACP reductase FabI -
  I6H64_RS04280 (I6H64_04280) accA 858386..859153 (-) 768 WP_002831518.1 carboxyltransferase subunit alpha -
  I6H64_RS04285 (I6H64_04285) - 859170..859994 (-) 825 WP_008842117.1 acetyl-CoA carboxylase carboxyltransferase subunit beta -
  I6H64_RS04290 (I6H64_04290) accC 859984..861351 (-) 1368 WP_008842118.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  I6H64_RS04295 (I6H64_04295) - 861368..861778 (-) 411 WP_036685722.1 3-hydroxyacyl-ACP dehydratase FabZ family protein -
  I6H64_RS04300 (I6H64_04300) - 861791..862213 (-) 423 WP_008842120.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  I6H64_RS04305 (I6H64_04305) fabF 862218..863444 (-) 1227 WP_036685725.1 beta-ketoacyl-ACP synthase II -
  I6H64_RS04310 (I6H64_04310) fabG 863460..864188 (-) 729 WP_008842122.1 3-oxoacyl-ACP reductase FabG -
  I6H64_RS04315 (I6H64_04315) - 864273..865217 (-) 945 WP_008842123.1 ACP S-malonyltransferase -
  I6H64_RS04320 (I6H64_04320) acpP 865244..865480 (-) 237 WP_002831510.1 acyl carrier protein -
  I6H64_RS04325 (I6H64_04325) - 865507..866466 (-) 960 WP_008842124.1 beta-ketoacyl-ACP synthase III -
  I6H64_RS04330 (I6H64_04330) fabZ 866479..866928 (-) 450 WP_002831508.1 3-hydroxyacyl-ACP dehydratase FabZ -
  I6H64_RS04335 (I6H64_04335) - 867325..867657 (+) 333 WP_008842125.1 DsrE family protein -
  I6H64_RS04340 (I6H64_04340) - 867679..868005 (+) 327 WP_008842126.1 heavy metal-binding domain-containing protein -
  I6H64_RS04345 (I6H64_04345) - 868303..868893 (-) 591 WP_036685728.1 hypothetical protein -
  I6H64_RS04350 (I6H64_04350) - 868921..869955 (-) 1035 WP_008842128.1 hypothetical protein -
  I6H64_RS04355 (I6H64_04355) - 870169..871380 (+) 1212 WP_148276886.1 ISL3 family transposase -
  I6H64_RS04360 (I6H64_04360) rplS 871515..871886 (-) 372 WP_002831503.1 50S ribosomal protein L19 -
  I6H64_RS04365 (I6H64_04365) - 872002..872757 (-) 756 WP_004165726.1 ABC transporter permease -
  I6H64_RS04370 (I6H64_04370) - 872741..873406 (-) 666 WP_005916672.1 ATP-binding cassette domain-containing protein -

Sequence


Protein


Download         Length: 158 a.a.        Molecular weight: 17648.30 Da        Isoelectric Point: 4.5762

>NTDB_id=516780 I6H64_RS04150 WP_008840867.1 845574..846050(-) (ssb) [Pediococcus acidilactici strain FDAARGOS_1007]
MINRAVLIGRLTRDPELKYTTNGVAVASFNLAVNRQFTNQDGEREADFINCVMWRKAAEIFCDYTHKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSFLESKSQSNQNNGSYVPQDNGFGQNNGPTTPNNTNPNDPFSGKQGQSIDITDEDLPF

Nucleotide


Download         Length: 477 bp        

>NTDB_id=516780 I6H64_RS04150 WP_008840867.1 845574..846050(-) (ssb) [Pediococcus acidilactici strain FDAARGOS_1007]
ATGATTAACCGAGCGGTATTAATCGGGCGCTTAACAAGGGACCCAGAACTAAAGTACACAACCAATGGCGTAGCGGTCGC
TAGCTTTAACCTAGCAGTCAATCGCCAATTCACAAACCAAGATGGCGAACGTGAAGCAGATTTTATCAATTGCGTAATGT
GGCGGAAAGCGGCAGAAATTTTCTGCGACTATACTCACAAAGGTTCGTTGGTTGGCATTGATGGACGAATCCAAACTCGT
TCATACGAAAATCAACAAGGACAACGTGTTTATGTCACTGAAGTGGTCGCGGATAACTTTTCCTTTTTGGAATCTAAAAG
TCAGAGCAATCAAAACAATGGCAGTTATGTGCCACAAGACAACGGGTTTGGTCAAAATAATGGGCCAACTACGCCGAATA
ACACGAACCCAAATGATCCGTTTAGCGGAAAGCAAGGGCAATCCATTGATATCACCGATGAAGATTTACCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.895

100

0.627

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.491

100

0.608

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.089

0.399

  ssbB Streptococcus sobrinus strain NIDR 6715-7

51.282

74.051

0.38