Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I6I07_RS19330 | Genome accession | NZ_CP065997 |
| Coordinates | 4253252..4253707 (-) | Length | 151 a.a. |
| NCBI ID | WP_198483300.1 | Uniprot ID | A0A7T4AZA2 |
| Organism | Achromobacter deleyi strain FDAARGOS_1050 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4241855..4294558 | 4253252..4253707 | within | 0 |
Gene organization within MGE regions
Location: 4241855..4294558
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6I07_RS19245 (I6I07_19245) | - | 4241855..4243102 (-) | 1248 | WP_198483284.1 | Arm DNA-binding domain-containing protein | - |
| I6I07_RS19250 (I6I07_19250) | - | 4243245..4243514 (-) | 270 | WP_198483285.1 | hypothetical protein | - |
| I6I07_RS19255 (I6I07_19255) | - | 4243507..4243932 (-) | 426 | WP_198483286.1 | hypothetical protein | - |
| I6I07_RS19260 (I6I07_19260) | - | 4243925..4245004 (-) | 1080 | WP_198487733.1 | hypothetical protein | - |
| I6I07_RS19265 (I6I07_19265) | - | 4245001..4245264 (-) | 264 | WP_198483287.1 | hypothetical protein | - |
| I6I07_RS19270 (I6I07_19270) | - | 4245261..4247303 (-) | 2043 | WP_198483288.1 | DNA cytosine methyltransferase | - |
| I6I07_RS19275 (I6I07_19275) | - | 4247499..4248131 (+) | 633 | WP_198483289.1 | hypothetical protein | - |
| I6I07_RS19280 (I6I07_19280) | - | 4248128..4248673 (-) | 546 | WP_198483290.1 | hypothetical protein | - |
| I6I07_RS19285 (I6I07_19285) | - | 4248673..4248945 (-) | 273 | WP_198483291.1 | hypothetical protein | - |
| I6I07_RS19290 (I6I07_19290) | - | 4248942..4249322 (-) | 381 | WP_198483292.1 | VVA0879 family protein | - |
| I6I07_RS19295 (I6I07_19295) | - | 4249319..4249738 (-) | 420 | WP_198483293.1 | hypothetical protein | - |
| I6I07_RS19300 (I6I07_19300) | - | 4249738..4250262 (-) | 525 | WP_198483294.1 | hypothetical protein | - |
| I6I07_RS19305 (I6I07_19305) | - | 4250262..4250945 (-) | 684 | WP_198483295.1 | hypothetical protein | - |
| I6I07_RS19310 (I6I07_19310) | - | 4250942..4251148 (-) | 207 | WP_198483296.1 | hypothetical protein | - |
| I6I07_RS19315 (I6I07_19315) | - | 4251145..4251936 (-) | 792 | WP_198483297.1 | ParB/RepB/Spo0J family partition protein | - |
| I6I07_RS19320 (I6I07_19320) | - | 4251947..4252846 (-) | 900 | WP_198483298.1 | recombination-associated protein RdgC | - |
| I6I07_RS19325 (I6I07_19325) | - | 4252868..4253227 (-) | 360 | WP_198483299.1 | hypothetical protein | - |
| I6I07_RS19330 (I6I07_19330) | ssb | 4253252..4253707 (-) | 456 | WP_198483300.1 | single-stranded DNA-binding protein | Machinery gene |
| I6I07_RS19335 (I6I07_19335) | - | 4253710..4254366 (-) | 657 | WP_198483301.1 | hypothetical protein | - |
| I6I07_RS19340 (I6I07_19340) | - | 4254426..4254704 (-) | 279 | WP_198483302.1 | hypothetical protein | - |
| I6I07_RS19345 (I6I07_19345) | - | 4254945..4255124 (-) | 180 | WP_198483303.1 | hypothetical protein | - |
| I6I07_RS19350 (I6I07_19350) | - | 4255585..4255788 (-) | 204 | WP_198483304.1 | hypothetical protein | - |
| I6I07_RS19355 (I6I07_19355) | - | 4255793..4256014 (-) | 222 | WP_100507280.1 | hypothetical protein | - |
| I6I07_RS19360 (I6I07_19360) | - | 4256017..4256688 (-) | 672 | WP_198483305.1 | hypothetical protein | - |
| I6I07_RS19365 (I6I07_19365) | - | 4257260..4258321 (-) | 1062 | WP_198483306.1 | S24 family peptidase | - |
| I6I07_RS19370 (I6I07_19370) | - | 4258361..4258579 (+) | 219 | WP_198483307.1 | hypothetical protein | - |
| I6I07_RS19375 (I6I07_19375) | - | 4258756..4259199 (+) | 444 | WP_198483308.1 | phage regulatory CII family protein | - |
| I6I07_RS19380 (I6I07_19380) | - | 4259196..4259606 (+) | 411 | WP_198483309.1 | Ref family recombination enhancement nuclease | - |
| I6I07_RS19385 (I6I07_19385) | - | 4259603..4259893 (+) | 291 | WP_198483310.1 | hypothetical protein | - |
| I6I07_RS19390 (I6I07_19390) | - | 4259890..4260630 (+) | 741 | WP_198483311.1 | phage antirepressor KilAC domain-containing protein | - |
| I6I07_RS19395 (I6I07_19395) | - | 4260639..4261457 (+) | 819 | WP_198483312.1 | helix-turn-helix domain-containing protein | - |
| I6I07_RS19400 (I6I07_19400) | - | 4261454..4262134 (+) | 681 | WP_232625655.1 | DUF6475 domain-containing protein | - |
| I6I07_RS19405 (I6I07_19405) | - | 4262131..4262541 (+) | 411 | WP_198483313.1 | hypothetical protein | - |
| I6I07_RS19410 (I6I07_19410) | - | 4262837..4263040 (+) | 204 | WP_198483314.1 | hypothetical protein | - |
| I6I07_RS19415 (I6I07_19415) | - | 4263114..4263395 (+) | 282 | WP_232625656.1 | hypothetical protein | - |
| I6I07_RS19420 (I6I07_19420) | - | 4263737..4264411 (-) | 675 | WP_198483316.1 | hypothetical protein | - |
| I6I07_RS19425 (I6I07_19425) | - | 4264574..4265365 (+) | 792 | WP_198483317.1 | DNA adenine methylase | - |
| I6I07_RS19430 (I6I07_19430) | - | 4265541..4266326 (+) | 786 | WP_198483318.1 | hypothetical protein | - |
| I6I07_RS19435 (I6I07_19435) | - | 4266323..4266820 (+) | 498 | WP_061074211.1 | terminase small subunit | - |
| I6I07_RS19440 (I6I07_19440) | - | 4266817..4268892 (+) | 2076 | WP_232625657.1 | phage terminase large subunit family protein | - |
| I6I07_RS19445 (I6I07_19445) | - | 4268939..4269145 (+) | 207 | WP_061074212.1 | phage head-tail joining protein | - |
| I6I07_RS19450 (I6I07_19450) | - | 4269142..4270641 (+) | 1500 | WP_198483319.1 | phage portal protein | - |
| I6I07_RS19455 (I6I07_19455) | - | 4270670..4271797 (+) | 1128 | WP_198483320.1 | head maturation protease, ClpP-related | - |
| I6I07_RS19460 (I6I07_19460) | - | 4271825..4272175 (+) | 351 | WP_198483321.1 | head decoration protein | - |
| I6I07_RS19465 (I6I07_19465) | - | 4272257..4273261 (+) | 1005 | WP_061074215.1 | major capsid protein | - |
| I6I07_RS19470 (I6I07_19470) | - | 4273267..4273569 (+) | 303 | WP_198483322.1 | head-tail joining protein | - |
| I6I07_RS19475 (I6I07_19475) | - | 4273566..4273988 (+) | 423 | WP_198483323.1 | hypothetical protein | - |
| I6I07_RS19480 (I6I07_19480) | - | 4274015..4274218 (+) | 204 | WP_198483324.1 | hypothetical protein | - |
| I6I07_RS19485 (I6I07_19485) | - | 4274251..4275186 (+) | 936 | WP_198483325.1 | phage tail tube protein | - |
| I6I07_RS19490 (I6I07_19490) | - | 4275257..4275676 (+) | 420 | WP_061074219.1 | hypothetical protein | - |
| I6I07_RS19495 (I6I07_19495) | - | 4275742..4276053 (+) | 312 | WP_198483326.1 | DUF1799 domain-containing protein | - |
| I6I07_RS19500 (I6I07_19500) | - | 4276087..4279059 (+) | 2973 | WP_198483327.1 | phage tail tape measure protein | - |
| I6I07_RS19505 (I6I07_19505) | - | 4279059..4279400 (+) | 342 | WP_198483328.1 | phage tail protein | - |
| I6I07_RS19510 (I6I07_19510) | - | 4279406..4280971 (+) | 1566 | WP_198483329.1 | phage tail protein | - |
| I6I07_RS19515 (I6I07_19515) | - | 4280962..4281411 (+) | 450 | WP_198483330.1 | hypothetical protein | - |
| I6I07_RS19520 (I6I07_19520) | - | 4281420..4282148 (+) | 729 | WP_198483331.1 | phage minor tail protein L | - |
| I6I07_RS19525 (I6I07_19525) | - | 4282151..4282930 (+) | 780 | WP_198483332.1 | C40 family peptidase | - |
| I6I07_RS19530 (I6I07_19530) | - | 4282927..4283541 (+) | 615 | WP_198483333.1 | tail assembly protein | - |
| I6I07_RS19535 (I6I07_19535) | - | 4283538..4286714 (+) | 3177 | WP_198483334.1 | phage tail protein | - |
| I6I07_RS19540 (I6I07_19540) | - | 4287049..4287735 (+) | 687 | WP_225856603.1 | hypothetical protein | - |
| I6I07_RS19545 (I6I07_19545) | - | 4287836..4288315 (+) | 480 | WP_198483335.1 | hypothetical protein | - |
| I6I07_RS19550 (I6I07_19550) | - | 4288318..4288866 (+) | 549 | WP_198483336.1 | hypothetical protein | - |
| I6I07_RS19555 (I6I07_19555) | - | 4288871..4289116 (+) | 246 | WP_232625658.1 | hypothetical protein | - |
| I6I07_RS19560 (I6I07_19560) | - | 4289252..4289611 (-) | 360 | WP_198483338.1 | hypothetical protein | - |
| I6I07_RS19565 (I6I07_19565) | - | 4289667..4289849 (-) | 183 | WP_232625659.1 | hypothetical protein | - |
| I6I07_RS19570 (I6I07_19570) | - | 4290082..4290270 (+) | 189 | WP_198483340.1 | hypothetical protein | - |
| I6I07_RS19575 (I6I07_19575) | - | 4290274..4290957 (-) | 684 | WP_198483341.1 | SOS response-associated peptidase | - |
| I6I07_RS19580 (I6I07_19580) | - | 4290990..4291145 (-) | 156 | WP_198483342.1 | hypothetical protein | - |
| I6I07_RS31920 | - | 4291815..4291940 (+) | 126 | WP_006395902.1 | hypothetical protein | - |
| I6I07_RS19590 (I6I07_19590) | - | 4291969..4292550 (-) | 582 | WP_198483343.1 | hypothetical protein | - |
| I6I07_RS19595 (I6I07_19595) | - | 4292556..4293137 (-) | 582 | WP_198483344.1 | hypothetical protein | - |
| I6I07_RS19600 (I6I07_19600) | - | 4293181..4293693 (-) | 513 | WP_198483345.1 | hypothetical protein | - |
| I6I07_RS19605 (I6I07_19605) | - | 4293705..4294064 (-) | 360 | WP_198483346.1 | hypothetical protein | - |
| I6I07_RS19610 (I6I07_19610) | - | 4294169..4294528 (-) | 360 | WP_232625660.1 | lysozyme inhibitor LprI family protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16637.45 Da Isoelectric Point: 7.1679
>NTDB_id=516190 I6I07_RS19330 WP_198483300.1 4253252..4253707(-) (ssb) [Achromobacter deleyi strain FDAARGOS_1050]
MASVNKVILVGNLGRDPDIRYAPDGAAVCSMSIATTSTWKDRASGERREETEWHRVVMYNRLAEIAGEYLKKGRSVYIEG
RLKTRKWRDKDTGGDRYSTEIIGDQLQMLGGRDGQAEGGHAADAPDGSDSRRRQRPASAPPSDGTDPDIPF
MASVNKVILVGNLGRDPDIRYAPDGAAVCSMSIATTSTWKDRASGERREETEWHRVVMYNRLAEIAGEYLKKGRSVYIEG
RLKTRKWRDKDTGGDRYSTEIIGDQLQMLGGRDGQAEGGHAADAPDGSDSRRRQRPASAPPSDGTDPDIPF
Nucleotide
Download Length: 456 bp
>NTDB_id=516190 I6I07_RS19330 WP_198483300.1 4253252..4253707(-) (ssb) [Achromobacter deleyi strain FDAARGOS_1050]
ATGGCCTCAGTCAACAAAGTCATCCTGGTCGGCAACCTGGGGCGCGACCCGGACATCAGATATGCCCCCGATGGCGCCGC
CGTCTGCAGCATGTCGATCGCCACGACGTCCACGTGGAAAGACCGCGCCAGCGGTGAACGCCGCGAAGAAACCGAATGGC
ACCGCGTCGTCATGTACAACCGCCTGGCCGAAATCGCAGGCGAATACCTGAAGAAAGGCCGCTCGGTCTACATCGAGGGC
CGCCTGAAGACCCGCAAGTGGCGAGACAAGGACACCGGCGGCGACCGCTACAGCACCGAAATCATCGGCGATCAGCTGCA
GATGCTCGGCGGCCGTGACGGTCAAGCCGAAGGCGGCCACGCCGCCGACGCCCCGGACGGCTCAGACAGCCGGCGGCGCC
AACGCCCCGCCAGCGCCCCGCCCAGCGACGGAACCGACCCGGACATCCCCTTCTAG
ATGGCCTCAGTCAACAAAGTCATCCTGGTCGGCAACCTGGGGCGCGACCCGGACATCAGATATGCCCCCGATGGCGCCGC
CGTCTGCAGCATGTCGATCGCCACGACGTCCACGTGGAAAGACCGCGCCAGCGGTGAACGCCGCGAAGAAACCGAATGGC
ACCGCGTCGTCATGTACAACCGCCTGGCCGAAATCGCAGGCGAATACCTGAAGAAAGGCCGCTCGGTCTACATCGAGGGC
CGCCTGAAGACCCGCAAGTGGCGAGACAAGGACACCGGCGGCGACCGCTACAGCACCGAAATCATCGGCGATCAGCTGCA
GATGCTCGGCGGCCGTGACGGTCAAGCCGAAGGCGGCCACGCCGCCGACGCCCCGGACGGCTCAGACAGCCGGCGGCGCC
AACGCCCCGCCAGCGCCCCGCCCAGCGACGGAACCGACCCGGACATCCCCTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
48.619 |
100 |
0.583 |
| ssb | Vibrio cholerae strain A1552 |
48.876 |
100 |
0.576 |
| ssb | Neisseria meningitidis MC58 |
46.023 |
100 |
0.536 |
| ssb | Neisseria gonorrhoeae MS11 |
46.023 |
100 |
0.536 |