Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   I6H62_RS07615 Genome accession   NZ_CP065981
Coordinates   1398918..1399436 (-) Length   172 a.a.
NCBI ID   WP_041636241.1    Uniprot ID   -
Organism   Macrococcoides caseolyticum strain FDAARGOS_1005     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1386369..1437504 1398918..1399436 within 0


Gene organization within MGE regions


Location: 1386369..1437504
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6H62_RS07540 (I6H62_07540) - 1386369..1386737 (-) 369 WP_101042031.1 nuclear transport factor 2 family protein -
  I6H62_RS07545 (I6H62_07545) - 1387132..1387311 (+) 180 WP_086043593.1 hypothetical protein -
  I6H62_RS07550 (I6H62_07550) - 1387388..1387591 (+) 204 WP_101042030.1 DUF6366 family protein -
  I6H62_RS07555 (I6H62_07555) - 1387677..1388636 (-) 960 WP_198479334.1 IS30 family transposase -
  I6H62_RS07560 (I6H62_07560) - 1388761..1389168 (+) 408 Protein_1452 tyrosine-type recombinase/integrase -
  I6H62_RS07565 (I6H62_07565) - 1389165..1389425 (+) 261 WP_101042028.1 hypothetical protein -
  I6H62_RS07570 (I6H62_07570) - 1389437..1389826 (+) 390 WP_101042027.1 hypothetical protein -
  I6H62_RS07575 (I6H62_07575) - 1389994..1391135 (+) 1142 WP_198479331.1 IS3 family transposase -
  I6H62_RS07580 (I6H62_07580) guaA 1391215..1392756 (-) 1542 WP_015912440.1 glutamine-hydrolyzing GMP synthase -
  I6H62_RS07585 (I6H62_07585) guaB 1392820..1394289 (-) 1470 WP_133453264.1 IMP dehydrogenase -
  I6H62_RS07590 (I6H62_07590) - 1394334..1395602 (-) 1269 WP_198479335.1 nucleobase:cation symporter-2 family protein -
  I6H62_RS07595 (I6H62_07595) xpt 1395602..1396186 (-) 585 WP_099482390.1 xanthine phosphoribosyltransferase -
  I6H62_RS07600 (I6H62_07600) - 1396690..1397709 (+) 1020 WP_133453258.1 DUF2382 domain-containing protein -
  I6H62_RS07605 (I6H62_07605) - 1397810..1398424 (+) 615 WP_165980784.1 GNAT family N-acetyltransferase -
  I6H62_RS07610 (I6H62_07610) rpsR 1398643..1398885 (-) 243 WP_041636240.1 30S ribosomal protein S18 -
  I6H62_RS07615 (I6H62_07615) ssbA 1398918..1399436 (-) 519 WP_041636241.1 single-stranded DNA-binding protein Machinery gene
  I6H62_RS07620 (I6H62_07620) rpsF 1399461..1399751 (-) 291 WP_099482228.1 30S ribosomal protein S6 -
  I6H62_RS07625 (I6H62_07625) - 1399888..1400205 (-) 318 WP_101141212.1 hypothetical protein -
  I6H62_RS07630 (I6H62_07630) ychF 1400229..1401329 (-) 1101 WP_103214503.1 redox-regulated ATPase YchF -
  I6H62_RS07635 (I6H62_07635) - 1401348..1401536 (-) 189 WP_086039342.1 DUF951 domain-containing protein -
  I6H62_RS07640 (I6H62_07640) - 1401538..1402425 (-) 888 WP_086039343.1 mechanosensitive ion channel family protein -
  I6H62_RS07645 (I6H62_07645) - 1402426..1403289 (-) 864 WP_103214504.1 ParB/RepB/Spo0J family partition protein -
  I6H62_RS07650 (I6H62_07650) - 1403282..1404043 (-) 762 WP_101141208.1 ParA family protein -
  I6H62_RS07655 (I6H62_07655) noc 1404181..1405020 (-) 840 WP_103214505.1 nucleoid occlusion protein -
  I6H62_RS07660 (I6H62_07660) rsmG 1405050..1405766 (-) 717 WP_101141204.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  I6H62_RS07665 (I6H62_07665) mnmG 1405767..1407641 (-) 1875 WP_015912453.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  I6H62_RS07670 (I6H62_07670) mnmE 1407654..1409033 (-) 1380 WP_101142916.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  I6H62_RS07675 (I6H62_07675) jag 1409155..1409898 (-) 744 WP_232618416.1 RNA-binding cell elongation regulator Jag/EloR -
  I6H62_RS07680 (I6H62_07680) rnpA 1409915..1410262 (-) 348 WP_015912456.1 ribonuclease P protein component -
  I6H62_RS07685 (I6H62_07685) rpmH 1410361..1410498 (-) 138 WP_041636245.1 50S ribosomal protein L34 -
  I6H62_RS07690 (I6H62_07690) dnaA 1410973..1412310 (+) 1338 WP_101141200.1 chromosomal replication initiator protein DnaA -
  I6H62_RS07695 (I6H62_07695) dnaN 1412484..1413617 (+) 1134 WP_101141198.1 DNA polymerase III subunit beta -
  I6H62_RS07700 (I6H62_07700) - 1413714..1414610 (+) 897 WP_012655914.1 ABC transporter ATP-binding protein -
  I6H62_RS07705 (I6H62_07705) - 1414603..1415844 (+) 1242 WP_101143436.1 ABC transporter permease -
  I6H62_RS07710 (I6H62_07710) - 1415934..1416641 (+) 708 WP_101141194.1 DsbA family protein -
  I6H62_RS07715 (I6H62_07715) - 1416638..1417054 (+) 417 WP_198479336.1 disulfide oxidoreductase -
  I6H62_RS07720 (I6H62_07720) yaaA 1417193..1417414 (+) 222 WP_041635745.1 S4 domain-containing protein YaaA -
  I6H62_RS07725 (I6H62_07725) recF 1417411..1418520 (+) 1110 WP_101141193.1 DNA replication/repair protein RecF -
  I6H62_RS07730 (I6H62_07730) gyrB 1418528..1420456 (+) 1929 WP_181451721.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  I6H62_RS07735 (I6H62_07735) gyrA 1420484..1423120 (+) 2637 WP_198479337.1 DNA gyrase subunit A -
  I6H62_RS07740 (I6H62_07740) alsS 1423316..1424983 (+) 1668 WP_101141190.1 acetolactate synthase AlsS -
  I6H62_RS07745 (I6H62_07745) budA 1424994..1425695 (+) 702 WP_101141188.1 acetolactate decarboxylase -
  I6H62_RS07750 (I6H62_07750) - 1425719..1426537 (-) 819 WP_103214680.1 NAD(P)H-hydrate dehydratase -
  I6H62_RS07755 (I6H62_07755) serS 1426882..1428153 (+) 1272 WP_101141184.1 serine--tRNA ligase -
  I6H62_RS07760 (I6H62_07760) - 1428381..1428896 (+) 516 WP_099482225.1 YceI family protein -
  I6H62_RS07765 (I6H62_07765) - 1429028..1429939 (+) 912 WP_101141753.1 DUF2232 domain-containing protein -
  I6H62_RS07770 (I6H62_07770) - 1429969..1431930 (+) 1962 WP_133453256.1 DHH family phosphoesterase -
  I6H62_RS07775 (I6H62_07775) rplI 1431932..1432378 (+) 447 WP_012655928.1 50S ribosomal protein L9 -
  I6H62_RS07780 (I6H62_07780) dnaB 1432396..1433802 (+) 1407 WP_101141752.1 replicative DNA helicase -
  I6H62_RS07785 (I6H62_07785) - 1434125..1435414 (+) 1290 WP_101141750.1 adenylosuccinate synthase -
  I6H62_RS07790 (I6H62_07790) - 1435498..1436385 (-) 888 WP_101141695.1 YitT family protein -
  I6H62_RS07805 (I6H62_07805) yycF 1436803..1437504 (+) 702 WP_012655932.1 response regulator YycF -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 19033.61 Da        Isoelectric Point: 4.8835

>NTDB_id=515906 I6H62_RS07615 WP_041636241.1 1398918..1399436(-) (ssbA) [Macrococcoides caseolyticum strain FDAARGOS_1005]
MLNRVVLVGRLTKDPEYRVTTSGVSVATFTLAVNRTFTNAQGERQADFINCVVFRKQAENVNNFLHKGSLAGVDGRLQSR
SYDNQEGRKVYVTEVVCDSVQFLEPKNTNQSRTNSPSDDYSSYDQGSYGQTQGQNQNYQSSNNQQSNTSAPSNNPFANAT
GPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=515906 I6H62_RS07615 WP_041636241.1 1398918..1399436(-) (ssbA) [Macrococcoides caseolyticum strain FDAARGOS_1005]
TTGCTTAACCGAGTTGTATTAGTTGGTCGTTTAACTAAAGATCCAGAATACAGAGTCACAACATCAGGTGTGTCAGTCGC
TACATTTACTTTAGCAGTAAATAGAACATTTACTAATGCACAAGGAGAACGTCAGGCTGATTTTATCAACTGTGTCGTAT
TCCGTAAGCAAGCTGAAAATGTTAATAATTTCTTGCATAAAGGTAGTTTAGCTGGGGTTGATGGCAGATTGCAATCACGT
AGTTATGATAATCAAGAAGGACGTAAAGTATATGTTACTGAGGTCGTTTGTGATTCAGTTCAATTCCTTGAACCGAAGAA
CACTAATCAATCTCGTACAAACAGTCCGTCAGATGACTATTCTAGCTATGACCAAGGAAGTTATGGTCAGACACAAGGCC
AGAATCAAAACTATCAGTCATCAAACAATCAACAATCAAATACATCAGCACCATCAAATAACCCATTTGCGAATGCAACA
GGGCCAATTGATATCAGTGATGATGATTTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

62.5

100

0.64

  ssb Latilactobacillus sakei subsp. sakei 23K

53.977

100

0.552

  ssb Vibrio cholerae strain A1552

34.759

100

0.378

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

61.628

0.366