Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   I3J23_RS05225 Genome accession   NZ_CP065159
Coordinates   1001848..1001988 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain GXU-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 996848..1006988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3J23_RS05200 (I3J23_05200) - 997145..997528 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  I3J23_RS05205 (I3J23_05205) comA 997550..998194 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  I3J23_RS05210 (I3J23_05210) comP 998275..1000578 (-) 2304 WP_207579565.1 histidine kinase Regulator
  I3J23_RS05215 (I3J23_05215) comX 1000598..1000777 (-) 180 WP_306383677.1 competence pheromone ComX -
  I3J23_RS05220 (I3J23_05220) comQ 1000731..1001717 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  I3J23_RS05225 (I3J23_05225) degQ 1001848..1001988 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  I3J23_RS05235 (I3J23_05235) - 1002454..1002795 (+) 342 WP_046560014.1 hypothetical protein -
  I3J23_RS05240 (I3J23_05240) - 1002802..1004022 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  I3J23_RS05245 (I3J23_05245) - 1004152..1005618 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  I3J23_RS05250 (I3J23_05250) - 1005636..1006187 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  I3J23_RS05255 (I3J23_05255) - 1006284..1006682 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=507531 I3J23_RS05225 WP_003152043.1 1001848..1001988(-) (degQ) [Bacillus amyloliquefaciens strain GXU-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=507531 I3J23_RS05225 WP_003152043.1 1001848..1001988(-) (degQ) [Bacillus amyloliquefaciens strain GXU-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891