Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I0U47_RS07690 Genome accession   NZ_CP065146
Coordinates   1673054..1673551 (-) Length   165 a.a.
NCBI ID   WP_049212214.1    Uniprot ID   A0AAJ4RET5
Organism   Proteus mirabilis strain PmBJ020-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1669765..1712774 1673054..1673551 within 0


Gene organization within MGE regions


Location: 1669765..1712774
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I0U47_RS07645 (I0U47_07645) - 1669765..1670760 (-) 996 WP_124740978.1 tyrosine-type recombinase/integrase -
  I0U47_RS07650 (I0U47_07650) - 1670717..1670962 (-) 246 WP_049211074.1 excisionase -
  I0U47_RS07655 (I0U47_07655) - 1670959..1671297 (-) 339 WP_004247455.1 phage protein NinX family protein -
  I0U47_RS07660 (I0U47_07660) - 1671290..1671466 (-) 177 WP_012367596.1 hypothetical protein -
  I0U47_RS07665 (I0U47_07665) - 1671624..1671869 (-) 246 WP_049211072.1 hypothetical protein -
  I0U47_RS07670 (I0U47_07670) - 1671862..1672131 (-) 270 WP_049211071.1 hypothetical protein -
  I0U47_RS07675 (I0U47_07675) - 1672131..1672304 (-) 174 WP_232467315.1 hypothetical protein -
  I0U47_RS07680 (I0U47_07680) - 1672340..1672666 (-) 327 WP_036932464.1 hypothetical protein -
  I0U47_RS07685 (I0U47_07685) - 1672700..1673038 (-) 339 WP_049212213.1 hypothetical protein -
  I0U47_RS07690 (I0U47_07690) ssb 1673054..1673551 (-) 498 WP_049212214.1 single-stranded DNA-binding protein Machinery gene
  I0U47_RS07695 (I0U47_07695) - 1673544..1674077 (-) 534 WP_109829194.1 hypothetical protein -
  I0U47_RS07700 (I0U47_07700) - 1674134..1674961 (-) 828 WP_004247125.1 DUF2303 family protein -
  I0U47_RS07705 (I0U47_07705) - 1675027..1675401 (-) 375 WP_004247126.1 hypothetical protein -
  I0U47_RS07710 (I0U47_07710) - 1675609..1675812 (-) 204 WP_049255036.1 hypothetical protein -
  I0U47_RS07715 (I0U47_07715) - 1676065..1676802 (-) 738 WP_223852282.1 HIRAN domain-containing protein -
  I0U47_RS07720 (I0U47_07720) - 1676795..1677730 (-) 936 WP_036900929.1 hypothetical protein -
  I0U47_RS07725 (I0U47_07725) - 1677812..1678486 (-) 675 WP_049213205.1 S24 family peptidase -
  I0U47_RS07730 (I0U47_07730) - 1678582..1678809 (+) 228 WP_036900931.1 helix-turn-helix transcriptional regulator -
  I0U47_RS07735 (I0U47_07735) - 1678848..1679306 (+) 459 WP_124740977.1 YmfL family putative regulatory protein -
  I0U47_RS07740 (I0U47_07740) - 1679564..1679743 (+) 180 WP_124740979.1 DUF4222 domain-containing protein -
  I0U47_RS07745 (I0U47_07745) - 1679756..1680847 (+) 1092 WP_124740976.1 replication protein -
  I0U47_RS07750 (I0U47_07750) - 1681019..1681726 (+) 708 WP_124740975.1 phage antirepressor KilAC domain-containing protein -
  I0U47_RS07755 (I0U47_07755) - 1681726..1682751 (+) 1026 WP_088207156.1 DUF968 domain-containing protein -
  I0U47_RS07760 (I0U47_07760) - 1682779..1683459 (+) 681 WP_036901017.1 bacteriophage antitermination protein Q -
  I0U47_RS07765 (I0U47_07765) - 1683618..1683812 (+) 195 WP_036901019.1 hypothetical protein -
  I0U47_RS07770 (I0U47_07770) - 1683885..1684907 (+) 1023 WP_124740974.1 site-specific DNA-methyltransferase -
  I0U47_RS07775 (I0U47_07775) - 1685151..1685462 (+) 312 WP_109829144.1 hypothetical protein -
  I0U47_RS07780 (I0U47_07780) - 1685416..1685673 (-) 258 WP_109829143.1 hypothetical protein -
  I0U47_RS07785 (I0U47_07785) - 1685812..1686081 (+) 270 WP_004251611.1 hypothetical protein -
  I0U47_RS07790 (I0U47_07790) - 1686081..1686551 (+) 471 WP_004251609.1 lysozyme -
  I0U47_RS07795 (I0U47_07795) - 1686694..1687155 (+) 462 WP_004251606.1 lysis protein -
  I0U47_RS07800 (I0U47_07800) - 1688053..1688391 (+) 339 WP_004242468.1 HNH endonuclease -
  I0U47_RS07805 (I0U47_07805) - 1688510..1688977 (+) 468 WP_036905779.1 phage terminase small subunit P27 family -
  I0U47_RS07810 (I0U47_07810) - 1688931..1690673 (+) 1743 WP_124740973.1 terminase TerL endonuclease subunit -
  I0U47_RS07815 (I0U47_07815) - 1690674..1692005 (+) 1332 WP_063693233.1 phage portal protein -
  I0U47_RS07820 (I0U47_07820) - 1692002..1692853 (+) 852 WP_124740972.1 head maturation protease, ClpP-related -
  I0U47_RS07825 (I0U47_07825) - 1692865..1694079 (+) 1215 WP_058336091.1 phage major capsid protein -
  I0U47_RS07830 (I0U47_07830) - 1694125..1694337 (+) 213 WP_058336092.1 hypothetical protein -
  I0U47_RS07835 (I0U47_07835) - 1694337..1694663 (+) 327 WP_058336093.1 head-tail connector protein -
  I0U47_RS07840 (I0U47_07840) - 1694672..1695001 (+) 330 WP_108716966.1 phage head closure protein -
  I0U47_RS07845 (I0U47_07845) - 1694991..1695464 (+) 474 WP_108716967.1 HK97-gp10 family putative phage morphogenesis protein -
  I0U47_RS07850 (I0U47_07850) - 1695470..1695811 (+) 342 WP_004251583.1 DUF3168 domain-containing protein -
  I0U47_RS07855 (I0U47_07855) - 1695821..1696486 (+) 666 WP_058336217.1 hypothetical protein -
  I0U47_RS07860 (I0U47_07860) - 1696551..1696967 (+) 417 WP_124740971.1 hypothetical protein -
  I0U47_RS07865 (I0U47_07865) - 1697012..1697242 (+) 231 WP_004251574.1 DUF4035 domain-containing protein -
  I0U47_RS07870 (I0U47_07870) - 1697283..1700558 (+) 3276 WP_124740970.1 phage tail tape measure protein -
  I0U47_RS07875 (I0U47_07875) - 1700559..1701155 (+) 597 WP_049200983.1 hypothetical protein -
  I0U47_RS07880 (I0U47_07880) - 1701155..1701736 (+) 582 WP_004251564.1 hypothetical protein -
  I0U47_RS07885 (I0U47_07885) - 1701748..1702053 (+) 306 WP_004251562.1 hypothetical protein -
  I0U47_RS07890 (I0U47_07890) - 1702085..1702483 (+) 399 WP_004251558.1 hypothetical protein -
  I0U47_RS07895 (I0U47_07895) - 1702483..1706208 (+) 3726 WP_052169999.1 DUF1983 domain-containing protein -
  I0U47_RS07900 (I0U47_07900) - 1706198..1706530 (+) 333 WP_017627865.1 hypothetical protein -
  I0U47_RS07905 (I0U47_07905) - 1706530..1707216 (+) 687 WP_017627864.1 hypothetical protein -
  I0U47_RS07910 (I0U47_07910) - 1707213..1707479 (+) 267 WP_049202079.1 hypothetical protein -
  I0U47_RS07915 (I0U47_07915) - 1707496..1707756 (+) 261 WP_004247524.1 hypothetical protein -
  I0U47_RS07920 (I0U47_07920) - 1707896..1708366 (+) 471 WP_253846620.1 hypothetical protein -
  I0U47_RS07925 (I0U47_07925) - 1708459..1708764 (-) 306 WP_049211399.1 helix-turn-helix transcriptional regulator -
  I0U47_RS07930 (I0U47_07930) - 1709155..1709415 (-) 261 WP_230506988.1 hypothetical protein -
  I0U47_RS07935 (I0U47_07935) - 1709420..1709650 (-) 231 WP_046335367.1 DNA polymerase III subunit theta -
  I0U47_RS07940 (I0U47_07940) - 1709928..1710266 (+) 339 WP_004243134.1 Grx4 family monothiol glutaredoxin -
  I0U47_RS07945 (I0U47_07945) tnpA 1710418..1710834 (-) 417 WP_004248160.1 IS200/IS605 family transposase -
  I0U47_RS07950 (I0U47_07950) - 1710857..1712065 (+) 1209 WP_165544889.1 RNA-guided endonuclease TnpB family protein -
  I0U47_RS07955 (I0U47_07955) rnt 1712136..1712774 (-) 639 WP_004243132.1 ribonuclease T -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 17966.31 Da        Isoelectric Point: 7.1636

>NTDB_id=507310 I0U47_RS07690 WP_049212214.1 1673054..1673551(-) (ssb) [Proteus mirabilis strain PmBJ020-1]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEIVVKIGGSMQMLGGASKSAGSQPAQQNPPPAQPQAQSSQPPMDFDDDIPFAPIGLPYPRH
AIYVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=507310 I0U47_RS07690 WP_049212214.1 1673054..1673551(-) (ssb) [Proteus mirabilis strain PmBJ020-1]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACATCAGAAAAATGGCGTGACAAACAAACAGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTCGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTATGTAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGCGTTAAACGCTATACAACAGAAATTGTTGTAAAGATTGGCGG
TTCAATGCAAATGCTAGGTGGTGCTAGTAAATCAGCAGGTTCACAACCGGCACAGCAAAACCCGCCACCGGCTCAACCTC
AAGCACAGAGTAGTCAACCACCAATGGATTTCGATGACGACATCCCCTTTGCCCCTATCGGACTCCCCTACCCACGCCAC
GCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.627

100

0.618

  ssb Glaesserella parasuis strain SC1401

50

100

0.545

  ssb Neisseria meningitidis MC58

42.938

100

0.461

  ssb Neisseria gonorrhoeae MS11

42.938

100

0.461