Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   IR195_RS09485 Genome accession   NZ_CP065135
Coordinates   1992842..1993387 (-) Length   181 a.a.
NCBI ID   WP_206049581.1    Uniprot ID   -
Organism   Vreelandella venusta strain PBH     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1987075..2046921 1992842..1993387 within 0


Gene organization within MGE regions


Location: 1987075..2046921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IR195_RS09440 (IR195_09435) - 1987075..1987587 (-) 513 WP_206049572.1 hypothetical protein -
  IR195_RS09445 (IR195_09440) - 1987948..1988967 (-) 1020 WP_206049573.1 tyrosine-type recombinase/integrase -
  IR195_RS09450 (IR195_09445) - 1988964..1989185 (-) 222 WP_206049574.1 DUF4224 domain-containing protein -
  IR195_RS09455 (IR195_09450) - 1989359..1989562 (+) 204 WP_206049575.1 hypothetical protein -
  IR195_RS09460 (IR195_09455) - 1989813..1990148 (-) 336 WP_206049576.1 hypothetical protein -
  IR195_RS09465 (IR195_09460) - 1990196..1990621 (-) 426 WP_206049577.1 hypothetical protein -
  IR195_RS09470 (IR195_09465) - 1990716..1990955 (-) 240 WP_206049578.1 hypothetical protein -
  IR195_RS09475 (IR195_09470) - 1991331..1992059 (+) 729 WP_206049579.1 hypothetical protein -
  IR195_RS09480 (IR195_09475) - 1992251..1992829 (-) 579 WP_206049580.1 hypothetical protein -
  IR195_RS09485 (IR195_09480) ssb 1992842..1993387 (-) 546 WP_206049581.1 single-stranded DNA-binding protein Machinery gene
  IR195_RS09490 (IR195_09485) - 1993440..1994234 (-) 795 WP_206049582.1 DUF2303 family protein -
  IR195_RS09495 (IR195_09490) - 1994234..1994593 (-) 360 WP_206049583.1 hypothetical protein -
  IR195_RS09500 (IR195_09495) - 1994707..1995510 (+) 804 WP_206049584.1 hypothetical protein -
  IR195_RS09505 (IR195_09500) - 1995558..1996517 (-) 960 WP_206049585.1 hypothetical protein -
  IR195_RS09510 (IR195_09505) - 1996510..1997352 (-) 843 WP_206049586.1 hypothetical protein -
  IR195_RS09515 (IR195_09510) - 1997431..1997595 (-) 165 WP_206049587.1 hypothetical protein -
  IR195_RS09520 (IR195_09515) - 1997592..1997888 (-) 297 WP_206049588.1 hypothetical protein -
  IR195_RS09525 (IR195_09520) - 1997897..1998169 (-) 273 WP_206049589.1 hypothetical protein -
  IR195_RS09530 (IR195_09525) - 1998215..1998367 (-) 153 WP_206049590.1 hypothetical protein -
  IR195_RS09535 (IR195_09530) - 1998681..1998932 (+) 252 WP_206049591.1 hypothetical protein -
  IR195_RS09540 (IR195_09535) - 2000353..2001387 (-) 1035 WP_206049592.1 hypothetical protein -
  IR195_RS09545 (IR195_09540) - 2001450..2002154 (-) 705 WP_206049593.1 helix-turn-helix transcriptional regulator -
  IR195_RS09550 (IR195_09545) - 2002309..2002536 (+) 228 WP_206049594.1 hypothetical protein -
  IR195_RS09555 (IR195_09550) - 2002595..2002924 (+) 330 WP_206049595.1 hypothetical protein -
  IR195_RS09560 (IR195_09555) - 2002957..2003148 (+) 192 WP_206049596.1 hypothetical protein -
  IR195_RS20535 - 2003145..2003276 (-) 132 WP_277395565.1 hypothetical protein -
  IR195_RS09565 (IR195_09560) - 2003288..2004229 (+) 942 WP_206049597.1 replication protein -
  IR195_RS09570 (IR195_09565) - 2004232..2005053 (+) 822 WP_206049598.1 ATP-binding protein -
  IR195_RS09575 (IR195_09570) - 2005050..2005562 (+) 513 WP_206049599.1 hypothetical protein -
  IR195_RS09580 (IR195_09575) - 2005552..2005863 (+) 312 WP_206049600.1 hypothetical protein -
  IR195_RS09585 (IR195_09580) - 2005863..2006231 (+) 369 WP_206049601.1 hypothetical protein -
  IR195_RS09590 (IR195_09585) - 2006657..2007211 (+) 555 WP_241006824.1 hypothetical protein -
  IR195_RS09595 (IR195_09590) - 2007237..2008244 (+) 1008 WP_206049603.1 hypothetical protein -
  IR195_RS09600 (IR195_09595) - 2008358..2008942 (+) 585 WP_206049604.1 hypothetical protein -
  IR195_RS09605 (IR195_09600) - 2009088..2009441 (+) 354 WP_206049605.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  IR195_RS09610 (IR195_09605) - 2009474..2009761 (+) 288 WP_206049606.1 hypothetical protein -
  IR195_RS09615 (IR195_09610) - 2009758..2010219 (+) 462 WP_089038244.1 3TM-type holin -
  IR195_RS09620 (IR195_09615) - 2010558..2010746 (+) 189 WP_089038242.1 hypothetical protein -
  IR195_RS09625 (IR195_09620) - 2010883..2011146 (-) 264 WP_206049607.1 hypothetical protein -
  IR195_RS09630 (IR195_09625) - 2011266..2011835 (+) 570 WP_206049608.1 hypothetical protein -
  IR195_RS09635 (IR195_09630) - 2011816..2013426 (+) 1611 WP_206049609.1 terminase -
  IR195_RS09640 (IR195_09635) - 2013447..2013896 (+) 450 WP_206049610.1 hypothetical protein -
  IR195_RS09645 (IR195_09640) - 2013889..2016147 (+) 2259 WP_206049611.1 hypothetical protein -
  IR195_RS09650 (IR195_09645) - 2016401..2017339 (+) 939 WP_206049612.1 hypothetical protein -
  IR195_RS09655 (IR195_09650) - 2017391..2018335 (+) 945 WP_206049613.1 P22 phage major capsid protein family protein -
  IR195_RS09660 (IR195_09655) - 2018392..2018712 (+) 321 WP_206049614.1 hypothetical protein -
  IR195_RS09665 (IR195_09660) - 2018716..2019417 (+) 702 WP_206049615.1 DUF6682 family protein -
  IR195_RS09670 (IR195_09665) - 2019417..2019947 (+) 531 WP_206049616.1 hypothetical protein -
  IR195_RS09675 (IR195_09670) - 2019957..2020991 (+) 1035 WP_206049617.1 hypothetical protein -
  IR195_RS09680 (IR195_09675) - 2020988..2021380 (+) 393 WP_206049618.1 hypothetical protein -
  IR195_RS09685 (IR195_09680) - 2021377..2021793 (+) 417 WP_206049619.1 hypothetical protein -
  IR195_RS09690 (IR195_09685) - 2021859..2023484 (+) 1626 WP_206049620.1 hypothetical protein -
  IR195_RS09695 (IR195_09690) - 2023512..2027426 (+) 3915 WP_206049621.1 hypothetical protein -
  IR195_RS09700 (IR195_09695) - 2027427..2027795 (+) 369 WP_206049622.1 hypothetical protein -
  IR195_RS09705 (IR195_09700) - 2027785..2028153 (+) 369 WP_206049623.1 hypothetical protein -
  IR195_RS09710 (IR195_09705) - 2028185..2028697 (+) 513 WP_206049624.1 hypothetical protein -
  IR195_RS09715 (IR195_09710) - 2028694..2029314 (+) 621 WP_206049625.1 hypothetical protein -
  IR195_RS09720 (IR195_09715) - 2029317..2029793 (+) 477 WP_206049626.1 hypothetical protein -
  IR195_RS09725 (IR195_09720) - 2029790..2030050 (+) 261 WP_206049627.1 hypothetical protein -
  IR195_RS09730 (IR195_09725) - 2030060..2031316 (+) 1257 WP_206049628.1 hypothetical protein -
  IR195_RS09735 (IR195_09730) - 2031336..2040017 (+) 8682 WP_206049629.1 LPD38 domain-containing protein -
  IR195_RS09740 (IR195_09735) - 2040026..2040223 (-) 198 WP_206049630.1 hypothetical protein -
  IR195_RS09745 (IR195_09740) - 2040235..2040876 (-) 642 WP_206049631.1 hypothetical protein -
  IR195_RS09750 (IR195_09745) - 2041059..2041577 (-) 519 WP_206049632.1 hypothetical protein -
  IR195_RS09755 (IR195_09750) - 2041558..2041908 (-) 351 WP_206049633.1 STAS-like domain-containing protein -
  IR195_RS09760 (IR195_09755) - 2041905..2042945 (-) 1041 WP_206049634.1 hypothetical protein -
  IR195_RS09765 (IR195_09760) - 2043035..2043388 (-) 354 WP_206049635.1 hypothetical protein -
  IR195_RS09770 (IR195_09765) - 2043542..2043739 (+) 198 WP_206049636.1 hypothetical protein -
  IR195_RS09775 (IR195_09770) - 2043727..2043936 (-) 210 WP_206049637.1 hypothetical protein -
  IR195_RS09780 (IR195_09775) - 2044762..2045175 (-) 414 WP_206049638.1 hypothetical protein -
  IR195_RS09785 (IR195_09780) - 2045944..2046921 (+) 978 WP_206049639.1 LysR substrate-binding domain-containing protein -

Sequence


Protein


Download         Length: 181 a.a.        Molecular weight: 20260.20 Da        Isoelectric Point: 8.3311

>NTDB_id=507159 IR195_RS09485 WP_206049581.1 1992842..1993387(-) (ssb) [Vreelandella venusta strain PBH]
MARGINKVILIGNLGQDPEVRFTQGGTAVANINIATSDSWLDRNSGQRQERTEWHRVILFKKTAEIAQQYLKKGSKVYIE
GRLQTRKWQDQSGQDRYTTEVVANDMQMLDSGGQQQAPQQSGYQQPPQNQQRSGYQQPPPNNSGYGGAQQPQGHRPPQGQ
QPYGAPDPGQYANFDDSEIPF

Nucleotide


Download         Length: 546 bp        

>NTDB_id=507159 IR195_RS09485 WP_206049581.1 1992842..1993387(-) (ssb) [Vreelandella venusta strain PBH]
ATGGCCCGAGGCATTAATAAAGTCATCTTGATTGGCAACCTGGGCCAAGACCCAGAAGTACGATTCACTCAAGGCGGCAC
AGCCGTCGCCAATATCAACATTGCCACCAGTGACAGCTGGCTAGACCGCAACAGCGGCCAGCGACAGGAACGCACCGAGT
GGCACCGCGTCATCTTATTCAAGAAAACGGCAGAGATTGCCCAGCAGTATTTGAAGAAAGGCAGCAAGGTCTACATCGAA
GGCCGACTCCAAACCCGCAAATGGCAAGACCAAAGCGGGCAAGACCGCTACACCACGGAAGTCGTTGCTAACGATATGCA
AATGCTAGATAGCGGCGGGCAGCAGCAAGCCCCACAACAAAGCGGGTACCAGCAACCGCCTCAGAATCAGCAGCGCAGTG
GCTACCAACAGCCGCCTCCGAATAATTCAGGCTATGGCGGTGCGCAGCAGCCCCAAGGTCATCGACCACCACAAGGGCAG
CAGCCATATGGCGCGCCTGATCCTGGCCAGTACGCCAATTTTGATGATTCGGAAATACCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

52.105

100

0.547

  ssb Glaesserella parasuis strain SC1401

49.18

100

0.497

  ssb Neisseria gonorrhoeae MS11

47.283

100

0.481

  ssb Neisseria meningitidis MC58

46.703

100

0.47