Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | IR195_RS09485 | Genome accession | NZ_CP065135 |
| Coordinates | 1992842..1993387 (-) | Length | 181 a.a. |
| NCBI ID | WP_206049581.1 | Uniprot ID | - |
| Organism | Vreelandella venusta strain PBH | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1987075..2046921 | 1992842..1993387 | within | 0 |
Gene organization within MGE regions
Location: 1987075..2046921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IR195_RS09440 (IR195_09435) | - | 1987075..1987587 (-) | 513 | WP_206049572.1 | hypothetical protein | - |
| IR195_RS09445 (IR195_09440) | - | 1987948..1988967 (-) | 1020 | WP_206049573.1 | tyrosine-type recombinase/integrase | - |
| IR195_RS09450 (IR195_09445) | - | 1988964..1989185 (-) | 222 | WP_206049574.1 | DUF4224 domain-containing protein | - |
| IR195_RS09455 (IR195_09450) | - | 1989359..1989562 (+) | 204 | WP_206049575.1 | hypothetical protein | - |
| IR195_RS09460 (IR195_09455) | - | 1989813..1990148 (-) | 336 | WP_206049576.1 | hypothetical protein | - |
| IR195_RS09465 (IR195_09460) | - | 1990196..1990621 (-) | 426 | WP_206049577.1 | hypothetical protein | - |
| IR195_RS09470 (IR195_09465) | - | 1990716..1990955 (-) | 240 | WP_206049578.1 | hypothetical protein | - |
| IR195_RS09475 (IR195_09470) | - | 1991331..1992059 (+) | 729 | WP_206049579.1 | hypothetical protein | - |
| IR195_RS09480 (IR195_09475) | - | 1992251..1992829 (-) | 579 | WP_206049580.1 | hypothetical protein | - |
| IR195_RS09485 (IR195_09480) | ssb | 1992842..1993387 (-) | 546 | WP_206049581.1 | single-stranded DNA-binding protein | Machinery gene |
| IR195_RS09490 (IR195_09485) | - | 1993440..1994234 (-) | 795 | WP_206049582.1 | DUF2303 family protein | - |
| IR195_RS09495 (IR195_09490) | - | 1994234..1994593 (-) | 360 | WP_206049583.1 | hypothetical protein | - |
| IR195_RS09500 (IR195_09495) | - | 1994707..1995510 (+) | 804 | WP_206049584.1 | hypothetical protein | - |
| IR195_RS09505 (IR195_09500) | - | 1995558..1996517 (-) | 960 | WP_206049585.1 | hypothetical protein | - |
| IR195_RS09510 (IR195_09505) | - | 1996510..1997352 (-) | 843 | WP_206049586.1 | hypothetical protein | - |
| IR195_RS09515 (IR195_09510) | - | 1997431..1997595 (-) | 165 | WP_206049587.1 | hypothetical protein | - |
| IR195_RS09520 (IR195_09515) | - | 1997592..1997888 (-) | 297 | WP_206049588.1 | hypothetical protein | - |
| IR195_RS09525 (IR195_09520) | - | 1997897..1998169 (-) | 273 | WP_206049589.1 | hypothetical protein | - |
| IR195_RS09530 (IR195_09525) | - | 1998215..1998367 (-) | 153 | WP_206049590.1 | hypothetical protein | - |
| IR195_RS09535 (IR195_09530) | - | 1998681..1998932 (+) | 252 | WP_206049591.1 | hypothetical protein | - |
| IR195_RS09540 (IR195_09535) | - | 2000353..2001387 (-) | 1035 | WP_206049592.1 | hypothetical protein | - |
| IR195_RS09545 (IR195_09540) | - | 2001450..2002154 (-) | 705 | WP_206049593.1 | helix-turn-helix transcriptional regulator | - |
| IR195_RS09550 (IR195_09545) | - | 2002309..2002536 (+) | 228 | WP_206049594.1 | hypothetical protein | - |
| IR195_RS09555 (IR195_09550) | - | 2002595..2002924 (+) | 330 | WP_206049595.1 | hypothetical protein | - |
| IR195_RS09560 (IR195_09555) | - | 2002957..2003148 (+) | 192 | WP_206049596.1 | hypothetical protein | - |
| IR195_RS20535 | - | 2003145..2003276 (-) | 132 | WP_277395565.1 | hypothetical protein | - |
| IR195_RS09565 (IR195_09560) | - | 2003288..2004229 (+) | 942 | WP_206049597.1 | replication protein | - |
| IR195_RS09570 (IR195_09565) | - | 2004232..2005053 (+) | 822 | WP_206049598.1 | ATP-binding protein | - |
| IR195_RS09575 (IR195_09570) | - | 2005050..2005562 (+) | 513 | WP_206049599.1 | hypothetical protein | - |
| IR195_RS09580 (IR195_09575) | - | 2005552..2005863 (+) | 312 | WP_206049600.1 | hypothetical protein | - |
| IR195_RS09585 (IR195_09580) | - | 2005863..2006231 (+) | 369 | WP_206049601.1 | hypothetical protein | - |
| IR195_RS09590 (IR195_09585) | - | 2006657..2007211 (+) | 555 | WP_241006824.1 | hypothetical protein | - |
| IR195_RS09595 (IR195_09590) | - | 2007237..2008244 (+) | 1008 | WP_206049603.1 | hypothetical protein | - |
| IR195_RS09600 (IR195_09595) | - | 2008358..2008942 (+) | 585 | WP_206049604.1 | hypothetical protein | - |
| IR195_RS09605 (IR195_09600) | - | 2009088..2009441 (+) | 354 | WP_206049605.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| IR195_RS09610 (IR195_09605) | - | 2009474..2009761 (+) | 288 | WP_206049606.1 | hypothetical protein | - |
| IR195_RS09615 (IR195_09610) | - | 2009758..2010219 (+) | 462 | WP_089038244.1 | 3TM-type holin | - |
| IR195_RS09620 (IR195_09615) | - | 2010558..2010746 (+) | 189 | WP_089038242.1 | hypothetical protein | - |
| IR195_RS09625 (IR195_09620) | - | 2010883..2011146 (-) | 264 | WP_206049607.1 | hypothetical protein | - |
| IR195_RS09630 (IR195_09625) | - | 2011266..2011835 (+) | 570 | WP_206049608.1 | hypothetical protein | - |
| IR195_RS09635 (IR195_09630) | - | 2011816..2013426 (+) | 1611 | WP_206049609.1 | terminase | - |
| IR195_RS09640 (IR195_09635) | - | 2013447..2013896 (+) | 450 | WP_206049610.1 | hypothetical protein | - |
| IR195_RS09645 (IR195_09640) | - | 2013889..2016147 (+) | 2259 | WP_206049611.1 | hypothetical protein | - |
| IR195_RS09650 (IR195_09645) | - | 2016401..2017339 (+) | 939 | WP_206049612.1 | hypothetical protein | - |
| IR195_RS09655 (IR195_09650) | - | 2017391..2018335 (+) | 945 | WP_206049613.1 | P22 phage major capsid protein family protein | - |
| IR195_RS09660 (IR195_09655) | - | 2018392..2018712 (+) | 321 | WP_206049614.1 | hypothetical protein | - |
| IR195_RS09665 (IR195_09660) | - | 2018716..2019417 (+) | 702 | WP_206049615.1 | DUF6682 family protein | - |
| IR195_RS09670 (IR195_09665) | - | 2019417..2019947 (+) | 531 | WP_206049616.1 | hypothetical protein | - |
| IR195_RS09675 (IR195_09670) | - | 2019957..2020991 (+) | 1035 | WP_206049617.1 | hypothetical protein | - |
| IR195_RS09680 (IR195_09675) | - | 2020988..2021380 (+) | 393 | WP_206049618.1 | hypothetical protein | - |
| IR195_RS09685 (IR195_09680) | - | 2021377..2021793 (+) | 417 | WP_206049619.1 | hypothetical protein | - |
| IR195_RS09690 (IR195_09685) | - | 2021859..2023484 (+) | 1626 | WP_206049620.1 | hypothetical protein | - |
| IR195_RS09695 (IR195_09690) | - | 2023512..2027426 (+) | 3915 | WP_206049621.1 | hypothetical protein | - |
| IR195_RS09700 (IR195_09695) | - | 2027427..2027795 (+) | 369 | WP_206049622.1 | hypothetical protein | - |
| IR195_RS09705 (IR195_09700) | - | 2027785..2028153 (+) | 369 | WP_206049623.1 | hypothetical protein | - |
| IR195_RS09710 (IR195_09705) | - | 2028185..2028697 (+) | 513 | WP_206049624.1 | hypothetical protein | - |
| IR195_RS09715 (IR195_09710) | - | 2028694..2029314 (+) | 621 | WP_206049625.1 | hypothetical protein | - |
| IR195_RS09720 (IR195_09715) | - | 2029317..2029793 (+) | 477 | WP_206049626.1 | hypothetical protein | - |
| IR195_RS09725 (IR195_09720) | - | 2029790..2030050 (+) | 261 | WP_206049627.1 | hypothetical protein | - |
| IR195_RS09730 (IR195_09725) | - | 2030060..2031316 (+) | 1257 | WP_206049628.1 | hypothetical protein | - |
| IR195_RS09735 (IR195_09730) | - | 2031336..2040017 (+) | 8682 | WP_206049629.1 | LPD38 domain-containing protein | - |
| IR195_RS09740 (IR195_09735) | - | 2040026..2040223 (-) | 198 | WP_206049630.1 | hypothetical protein | - |
| IR195_RS09745 (IR195_09740) | - | 2040235..2040876 (-) | 642 | WP_206049631.1 | hypothetical protein | - |
| IR195_RS09750 (IR195_09745) | - | 2041059..2041577 (-) | 519 | WP_206049632.1 | hypothetical protein | - |
| IR195_RS09755 (IR195_09750) | - | 2041558..2041908 (-) | 351 | WP_206049633.1 | STAS-like domain-containing protein | - |
| IR195_RS09760 (IR195_09755) | - | 2041905..2042945 (-) | 1041 | WP_206049634.1 | hypothetical protein | - |
| IR195_RS09765 (IR195_09760) | - | 2043035..2043388 (-) | 354 | WP_206049635.1 | hypothetical protein | - |
| IR195_RS09770 (IR195_09765) | - | 2043542..2043739 (+) | 198 | WP_206049636.1 | hypothetical protein | - |
| IR195_RS09775 (IR195_09770) | - | 2043727..2043936 (-) | 210 | WP_206049637.1 | hypothetical protein | - |
| IR195_RS09780 (IR195_09775) | - | 2044762..2045175 (-) | 414 | WP_206049638.1 | hypothetical protein | - |
| IR195_RS09785 (IR195_09780) | - | 2045944..2046921 (+) | 978 | WP_206049639.1 | LysR substrate-binding domain-containing protein | - |
Sequence
Protein
Download Length: 181 a.a. Molecular weight: 20260.20 Da Isoelectric Point: 8.3311
>NTDB_id=507159 IR195_RS09485 WP_206049581.1 1992842..1993387(-) (ssb) [Vreelandella venusta strain PBH]
MARGINKVILIGNLGQDPEVRFTQGGTAVANINIATSDSWLDRNSGQRQERTEWHRVILFKKTAEIAQQYLKKGSKVYIE
GRLQTRKWQDQSGQDRYTTEVVANDMQMLDSGGQQQAPQQSGYQQPPQNQQRSGYQQPPPNNSGYGGAQQPQGHRPPQGQ
QPYGAPDPGQYANFDDSEIPF
MARGINKVILIGNLGQDPEVRFTQGGTAVANINIATSDSWLDRNSGQRQERTEWHRVILFKKTAEIAQQYLKKGSKVYIE
GRLQTRKWQDQSGQDRYTTEVVANDMQMLDSGGQQQAPQQSGYQQPPQNQQRSGYQQPPPNNSGYGGAQQPQGHRPPQGQ
QPYGAPDPGQYANFDDSEIPF
Nucleotide
Download Length: 546 bp
>NTDB_id=507159 IR195_RS09485 WP_206049581.1 1992842..1993387(-) (ssb) [Vreelandella venusta strain PBH]
ATGGCCCGAGGCATTAATAAAGTCATCTTGATTGGCAACCTGGGCCAAGACCCAGAAGTACGATTCACTCAAGGCGGCAC
AGCCGTCGCCAATATCAACATTGCCACCAGTGACAGCTGGCTAGACCGCAACAGCGGCCAGCGACAGGAACGCACCGAGT
GGCACCGCGTCATCTTATTCAAGAAAACGGCAGAGATTGCCCAGCAGTATTTGAAGAAAGGCAGCAAGGTCTACATCGAA
GGCCGACTCCAAACCCGCAAATGGCAAGACCAAAGCGGGCAAGACCGCTACACCACGGAAGTCGTTGCTAACGATATGCA
AATGCTAGATAGCGGCGGGCAGCAGCAAGCCCCACAACAAAGCGGGTACCAGCAACCGCCTCAGAATCAGCAGCGCAGTG
GCTACCAACAGCCGCCTCCGAATAATTCAGGCTATGGCGGTGCGCAGCAGCCCCAAGGTCATCGACCACCACAAGGGCAG
CAGCCATATGGCGCGCCTGATCCTGGCCAGTACGCCAATTTTGATGATTCGGAAATACCGTTCTGA
ATGGCCCGAGGCATTAATAAAGTCATCTTGATTGGCAACCTGGGCCAAGACCCAGAAGTACGATTCACTCAAGGCGGCAC
AGCCGTCGCCAATATCAACATTGCCACCAGTGACAGCTGGCTAGACCGCAACAGCGGCCAGCGACAGGAACGCACCGAGT
GGCACCGCGTCATCTTATTCAAGAAAACGGCAGAGATTGCCCAGCAGTATTTGAAGAAAGGCAGCAAGGTCTACATCGAA
GGCCGACTCCAAACCCGCAAATGGCAAGACCAAAGCGGGCAAGACCGCTACACCACGGAAGTCGTTGCTAACGATATGCA
AATGCTAGATAGCGGCGGGCAGCAGCAAGCCCCACAACAAAGCGGGTACCAGCAACCGCCTCAGAATCAGCAGCGCAGTG
GCTACCAACAGCCGCCTCCGAATAATTCAGGCTATGGCGGTGCGCAGCAGCCCCAAGGTCATCGACCACCACAAGGGCAG
CAGCCATATGGCGCGCCTGATCCTGGCCAGTACGCCAATTTTGATGATTCGGAAATACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
52.105 |
100 |
0.547 |
| ssb | Glaesserella parasuis strain SC1401 |
49.18 |
100 |
0.497 |
| ssb | Neisseria gonorrhoeae MS11 |
47.283 |
100 |
0.481 |
| ssb | Neisseria meningitidis MC58 |
46.703 |
100 |
0.47 |