Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NT08PM_RS00280 | Genome accession | NC_017764 |
| Coordinates | 45167..45619 (-) | Length | 150 a.a. |
| NCBI ID | WP_014667785.1 | Uniprot ID | - |
| Organism | Pasteurella multocida subsp. multocida str. 3480 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 39850..87713 | 45167..45619 | within | 0 |
Gene organization within MGE regions
Location: 39850..87713
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT08PM_RS00240 (NT08PM_0048) | - | 39850..40887 (-) | 1038 | WP_016533424.1 | tyrosine-type recombinase/integrase | - |
| NT08PM_RS11475 | - | 40896..41282 (-) | 387 | WP_016533425.1 | hypothetical protein | - |
| NT08PM_RS00245 (NT08PM_0049) | - | 41398..41853 (-) | 456 | WP_014390696.1 | hypothetical protein | - |
| NT08PM_RS00250 | - | 41898..42251 (-) | 354 | WP_041423219.1 | hypothetical protein | - |
| NT08PM_RS00255 (NT08PM_0050) | - | 42260..42757 (-) | 498 | WP_014391445.1 | DUF551 domain-containing protein | - |
| NT08PM_RS00260 (NT08PM_0051) | rdgC | 42901..43803 (-) | 903 | WP_014667784.1 | recombination-associated protein RdgC | - |
| NT08PM_RS00265 (NT08PM_0052) | - | 43806..44189 (-) | 384 | WP_014390700.1 | hypothetical protein | - |
| NT08PM_RS00270 (NT08PM_0053) | - | 44268..44579 (-) | 312 | WP_014390701.1 | DUF6378 domain-containing protein | - |
| NT08PM_RS00275 (NT08PM_0054) | - | 44579..45100 (-) | 522 | WP_014390702.1 | MazG-like family protein | - |
| NT08PM_RS00280 (NT08PM_0055) | ssb | 45167..45619 (-) | 453 | WP_014667785.1 | single-stranded DNA-binding protein | Machinery gene |
| NT08PM_RS00285 (NT08PM_0056) | - | 45630..46331 (-) | 702 | WP_014390704.1 | ERF family protein | - |
| NT08PM_RS00290 (NT08PM_0057) | - | 46374..47024 (-) | 651 | WP_014390705.1 | ribonuclease H-like domain-containing protein | - |
| NT08PM_RS11420 (NT08PM_0058) | - | 47197..47358 (-) | 162 | WP_014390707.1 | hypothetical protein | - |
| NT08PM_RS00295 (NT08PM_0059) | - | 47372..47608 (-) | 237 | WP_014667786.1 | hypothetical protein | - |
| NT08PM_RS00300 (NT08PM_0060) | - | 47580..47879 (-) | 300 | WP_014390709.1 | hypothetical protein | - |
| NT08PM_RS00305 (NT08PM_0061) | - | 48027..48257 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| NT08PM_RS00310 (NT08PM_0062) | - | 48319..48975 (-) | 657 | WP_014390711.1 | Bro-N domain-containing protein | - |
| NT08PM_RS00315 (NT08PM_0063) | - | 49260..50096 (-) | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| NT08PM_RS00320 (NT08PM_0064) | - | 50207..50584 (-) | 378 | WP_014390713.1 | hypothetical protein | - |
| NT08PM_RS00325 (NT08PM_0065) | - | 50559..50750 (-) | 192 | WP_014391100.1 | hypothetical protein | - |
| NT08PM_RS00330 | - | 51313..51540 (-) | 228 | WP_014390715.1 | hypothetical protein | - |
| NT08PM_RS00335 (NT08PM_0066) | - | 52049..52873 (-) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| NT08PM_RS00340 (NT08PM_0067) | - | 52870..53607 (-) | 738 | WP_014390717.1 | HipA family kinase | - |
| NT08PM_RS00345 (NT08PM_0068) | - | 53683..54369 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| NT08PM_RS00350 (NT08PM_0069) | - | 54497..54706 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| NT08PM_RS00355 (NT08PM_0070) | - | 54755..55207 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| NT08PM_RS00360 (NT08PM_0071) | - | 55266..55967 (+) | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
| NT08PM_RS00365 | - | 55964..56317 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| NT08PM_RS00370 (NT08PM_0072) | - | 56319..57218 (+) | 900 | WP_014390723.1 | hypothetical protein | - |
| NT08PM_RS00375 (NT08PM_0073) | - | 57218..57913 (+) | 696 | WP_014390724.1 | replication protein P | - |
| NT08PM_RS00380 (NT08PM_0074) | - | 57906..58436 (+) | 531 | WP_014390725.1 | MT-A70 family methyltransferase | - |
| NT08PM_RS00385 (NT08PM_0075) | - | 58445..58882 (+) | 438 | WP_014390726.1 | DUF1367 family protein | - |
| NT08PM_RS00390 (NT08PM_0077) | - | 59042..59257 (+) | 216 | WP_014667790.1 | hypothetical protein | - |
| NT08PM_RS00395 (NT08PM_0078) | - | 59250..59852 (+) | 603 | WP_014667791.1 | recombination protein NinG | - |
| NT08PM_RS00400 (NT08PM_0079) | - | 59853..60314 (+) | 462 | WP_014667792.1 | antiterminator Q family protein | - |
| NT08PM_RS00405 (NT08PM_0080) | - | 60440..61003 (-) | 564 | WP_014667793.1 | hypothetical protein | - |
| NT08PM_RS00410 (NT08PM_0081) | - | 61121..61381 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| NT08PM_RS00415 (NT08PM_0082) | - | 61378..61908 (+) | 531 | WP_014667794.1 | lysozyme | - |
| NT08PM_RS11245 (NT08PM_0083) | - | 61881..62204 (+) | 324 | WP_014667795.1 | DUF2570 family protein | - |
| NT08PM_RS00425 (NT08PM_0084) | - | 62426..62860 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NT08PM_RS11250 | - | 62889..63071 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| NT08PM_RS00430 (NT08PM_0085) | - | 63154..63651 (+) | 498 | WP_014390737.1 | terminase | - |
| NT08PM_RS00435 (NT08PM_0086) | - | 63635..64861 (+) | 1227 | WP_014667796.1 | PBSX family phage terminase large subunit | - |
| NT08PM_RS00440 (NT08PM_0087) | - | 64876..66321 (+) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| NT08PM_RS00445 (NT08PM_0088) | - | 66275..67246 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| NT08PM_RS00450 (NT08PM_0089) | - | 67261..68607 (+) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| NT08PM_RS00455 (NT08PM_0090) | - | 68607..69041 (+) | 435 | WP_014390742.1 | hypothetical protein | - |
| NT08PM_RS00460 (NT08PM_0091) | - | 69053..70051 (+) | 999 | WP_014390743.1 | major capsid protein | - |
| NT08PM_RS11480 | - | 70062..70565 (+) | 504 | WP_080573867.1 | hypothetical protein | - |
| NT08PM_RS00465 | - | 70546..70914 (+) | 369 | WP_014390745.1 | hypothetical protein | - |
| NT08PM_RS00470 | - | 70917..71261 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| NT08PM_RS00475 (NT08PM_0093) | - | 71266..71637 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| NT08PM_RS00480 | - | 71634..72005 (+) | 372 | WP_014390748.1 | hypothetical protein | - |
| NT08PM_RS00485 (NT08PM_0094) | - | 72017..72499 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| NT08PM_RS00490 (NT08PM_0095) | - | 72553..73224 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| NT08PM_RS00495 | - | 73301..73657 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| NT08PM_RS00500 (NT08PM_0096) | - | 73733..74551 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| NT08PM_RS00505 (NT08PM_0097) | - | 74890..75714 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| NT08PM_RS00510 (NT08PM_0098) | - | 75766..78210 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| NT08PM_RS00515 | - | 78213..78542 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| NT08PM_RS00520 (NT08PM_0099) | - | 78671..79375 (+) | 705 | WP_014390758.1 | phage minor tail protein L | - |
| NT08PM_RS00525 (NT08PM_0100) | - | 79380..80123 (+) | 744 | WP_014667798.1 | C40 family peptidase | - |
| NT08PM_RS00530 (NT08PM_0101) | - | 80066..80686 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| NT08PM_RS00535 (NT08PM_0102) | - | 80690..85693 (+) | 5004 | WP_014667800.1 | phage tail protein | - |
| NT08PM_RS00540 (NT08PM_0103) | - | 85741..86064 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| NT08PM_RS00545 (NT08PM_0104) | - | 86455..87201 (-) | 747 | WP_014390762.1 | hypothetical protein | - |
| NT08PM_RS00550 (NT08PM_0105) | - | 87201..87713 (-) | 513 | WP_014390763.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17092.00 Da Isoelectric Point: 7.9707
>NTDB_id=50704 NT08PM_RS00280 WP_014667785.1 45167..45619(-) (ssb) [Pasteurella multocida subsp. multocida str. 3480]
MVGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MVGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=50704 NT08PM_RS00280 WP_014667785.1 45167..45619(-) (ssb) [Pasteurella multocida subsp. multocida str. 3480]
ATGGTAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGTAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
61.667 |
100 |
0.74 |
| ssb | Vibrio cholerae strain A1552 |
53.957 |
92.667 |
0.5 |
| ssb | Neisseria gonorrhoeae MS11 |
46.043 |
92.667 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.043 |
92.667 |
0.427 |