Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPPC18_RS00205 Genome accession   NC_017742
Coordinates   37733..37846 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori PeCan18     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32733..42846
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPPC18_RS00180 (HPPC18_00150) - 32777..35002 (+) 2226 WP_000357186.1 AAA family ATPase -
  HPPC18_RS00185 (HPPC18_00155) panD 34992..35345 (+) 354 WP_000142218.1 aspartate 1-decarboxylase -
  HPPC18_RS00190 (HPPC18_00160) - 35348..35650 (+) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  HPPC18_RS00195 (HPPC18_00165) - 35650..36654 (+) 1005 WP_000468463.1 PDZ domain-containing protein -
  HPPC18_RS00200 (HPPC18_00170) comB6 36662..37717 (+) 1056 WP_000679730.1 type IV secretion system protein Machinery gene
  HPPC18_RS00205 (HPPC18_00175) comB7 37733..37846 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  HPPC18_RS00210 (HPPC18_00180) comB8 37843..38586 (+) 744 WP_000660566.1 type IV secretion system protein Machinery gene
  HPPC18_RS00215 (HPPC18_00185) comB9 38586..39572 (+) 987 WP_014662309.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPPC18_RS00220 (HPPC18_00190) comB10 39565..40695 (+) 1131 WP_001045746.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPPC18_RS00225 (HPPC18_00195) - 40765..42177 (+) 1413 WP_000694996.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=50553 HPPC18_RS00205 WP_001217877.1 37733..37846(+) (comB7) [Helicobacter pylori PeCan18]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=50553 HPPC18_RS00205 WP_001217877.1 37733..37846(+) (comB7) [Helicobacter pylori PeCan18]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACTTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment