Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   IRJ28_RS01920 Genome accession   NZ_CP064096
Coordinates   383324..383491 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain N1142-3at     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 378324..388491
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ28_RS01890 pncB 378469..379941 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ28_RS01895 pdeH 380078..381307 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ28_RS01900 - 381283..381651 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ28_RS01905 - 381765..381890 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ28_RS01910 degQ 382112..382252 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ28_RS01915 comQ 382437..383336 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ28_RS01920 comX 383324..383491 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ28_RS01925 comP 383506..385814 (+) 2309 Protein_381 two-component system sensor histidine kinase ComP -
  IRJ28_RS01930 comA 385895..386539 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ28_RS01935 yuxO 386558..386938 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  IRJ28_RS01940 mnhG 386977..387351 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  IRJ28_RS01945 mrpF 387335..387619 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  IRJ28_RS01950 mrpE 387619..388095 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=499442 IRJ28_RS01920 WP_003242801.1 383324..383491(+) (comX) [Bacillus subtilis strain N1142-3at]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=499442 IRJ28_RS01920 WP_003242801.1 383324..383491(+) (comX) [Bacillus subtilis strain N1142-3at]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1