Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IRJ28_RS01910 Genome accession   NZ_CP064096
Coordinates   382112..382252 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N1142-3at     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 377112..387252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ28_RS01880 yueI 377407..377805 (+) 399 WP_003242987.1 YueI family protein -
  IRJ28_RS01885 pncA 377902..378453 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  IRJ28_RS01890 pncB 378469..379941 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ28_RS01895 pdeH 380078..381307 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ28_RS01900 - 381283..381651 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ28_RS01905 - 381765..381890 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ28_RS01910 degQ 382112..382252 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ28_RS01915 comQ 382437..383336 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ28_RS01920 comX 383324..383491 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ28_RS01925 comP 383506..385814 (+) 2309 Protein_381 two-component system sensor histidine kinase ComP -
  IRJ28_RS01930 comA 385895..386539 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ28_RS01935 yuxO 386558..386938 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=499440 IRJ28_RS01910 WP_003220708.1 382112..382252(+) (degQ) [Bacillus subtilis strain N1142-3at]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=499440 IRJ28_RS01910 WP_003220708.1 382112..382252(+) (degQ) [Bacillus subtilis strain N1142-3at]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1