Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KHS93_RS11810 Genome accession   NZ_CP075547
Coordinates   2467914..2468087 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain SN16-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2462914..2473087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHS93_RS11795 (KHS93_11795) gcvT 2463732..2464832 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  KHS93_RS11800 (KHS93_11800) - 2465255..2466925 (+) 1671 WP_003153107.1 SNF2-related protein -
  KHS93_RS11805 (KHS93_11805) - 2466943..2467737 (+) 795 WP_069473503.1 YqhG family protein -
  KHS93_RS11810 (KHS93_11810) sinI 2467914..2468087 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KHS93_RS11815 (KHS93_11815) sinR 2468121..2468456 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHS93_RS11820 (KHS93_11820) - 2468504..2469289 (-) 786 WP_003153102.1 TasA family protein -
  KHS93_RS11825 (KHS93_11825) - 2469353..2469937 (-) 585 WP_003153100.1 signal peptidase I -
  KHS93_RS11830 (KHS93_11830) tapA 2469909..2470580 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  KHS93_RS11835 (KHS93_11835) - 2470839..2471168 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KHS93_RS11840 (KHS93_11840) - 2471208..2471387 (-) 180 WP_003153093.1 YqzE family protein -
  KHS93_RS11845 (KHS93_11845) comGG 2471444..2471821 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHS93_RS11850 (KHS93_11850) comGF 2471822..2472217 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF Machinery gene
  KHS93_RS11855 (KHS93_11855) comGE 2472231..2472545 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE Machinery gene
  KHS93_RS11860 (KHS93_11860) comGD 2472529..2472966 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=498829 KHS93_RS11810 WP_003153105.1 2467914..2468087(+) (sinI) [Bacillus amyloliquefaciens strain SN16-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=498829 KHS93_RS11810 WP_003153105.1 2467914..2468087(+) (sinI) [Bacillus amyloliquefaciens strain SN16-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702