Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IHV08_RS13010 Genome accession   NZ_CP062497
Coordinates   2504523..2504906 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain CV16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2499523..2509906
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IHV08_RS12970 (IHV08_12970) sinI 2500457..2500630 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  IHV08_RS12975 (IHV08_12975) sinR 2500664..2500999 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IHV08_RS12980 (IHV08_12980) tasA 2501092..2501877 (-) 786 WP_192857888.1 biofilm matrix protein TasA -
  IHV08_RS12985 (IHV08_12985) sipW 2501941..2502513 (-) 573 WP_192858455.1 signal peptidase I SipW -
  IHV08_RS12990 (IHV08_12990) tapA 2502497..2503258 (-) 762 WP_181217179.1 amyloid fiber anchoring/assembly protein TapA -
  IHV08_RS12995 (IHV08_12995) yqzG 2503530..2503856 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  IHV08_RS13000 (IHV08_13000) spoIITA 2503898..2504077 (-) 180 WP_003230176.1 YqzE family protein -
  IHV08_RS13005 (IHV08_13005) comGG 2504148..2504522 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  IHV08_RS13010 (IHV08_13010) comGF 2504523..2504906 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  IHV08_RS13015 (IHV08_13015) comGE 2504932..2505279 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IHV08_RS13020 (IHV08_13020) comGD 2505263..2505694 (-) 432 WP_181217182.1 comG operon protein ComGD Machinery gene
  IHV08_RS13025 (IHV08_13025) comGC 2505684..2505980 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  IHV08_RS13030 (IHV08_13030) comGB 2505994..2507031 (-) 1038 WP_181217183.1 comG operon protein ComGB Machinery gene
  IHV08_RS13035 (IHV08_13035) comGA 2507018..2508088 (-) 1071 WP_181217184.1 competence protein ComGA Machinery gene
  IHV08_RS13040 (IHV08_13040) corA 2508500..2509453 (-) 954 WP_181217185.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=490452 IHV08_RS13010 WP_015251713.1 2504523..2504906(-) (comGF) [Bacillus subtilis strain CV16]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=490452 IHV08_RS13010 WP_015251713.1 2504523..2504906(-) (comGF) [Bacillus subtilis strain CV16]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992