Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IHV08_RS12970 Genome accession   NZ_CP062497
Coordinates   2500457..2500630 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain CV16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2495457..2505630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IHV08_RS12955 (IHV08_12955) gcvT 2496256..2497344 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  IHV08_RS12960 (IHV08_12960) hepAA 2497786..2499459 (+) 1674 WP_004398544.1 SNF2-related protein -
  IHV08_RS12965 (IHV08_12965) yqhG 2499480..2500274 (+) 795 WP_003230200.1 YqhG family protein -
  IHV08_RS12970 (IHV08_12970) sinI 2500457..2500630 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  IHV08_RS12975 (IHV08_12975) sinR 2500664..2500999 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IHV08_RS12980 (IHV08_12980) tasA 2501092..2501877 (-) 786 WP_192857888.1 biofilm matrix protein TasA -
  IHV08_RS12985 (IHV08_12985) sipW 2501941..2502513 (-) 573 WP_192858455.1 signal peptidase I SipW -
  IHV08_RS12990 (IHV08_12990) tapA 2502497..2503258 (-) 762 WP_181217179.1 amyloid fiber anchoring/assembly protein TapA -
  IHV08_RS12995 (IHV08_12995) yqzG 2503530..2503856 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  IHV08_RS13000 (IHV08_13000) spoIITA 2503898..2504077 (-) 180 WP_003230176.1 YqzE family protein -
  IHV08_RS13005 (IHV08_13005) comGG 2504148..2504522 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  IHV08_RS13010 (IHV08_13010) comGF 2504523..2504906 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  IHV08_RS13015 (IHV08_13015) comGE 2504932..2505279 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=490449 IHV08_RS12970 WP_003230187.1 2500457..2500630(+) (sinI) [Bacillus subtilis strain CV16]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=490449 IHV08_RS12970 WP_003230187.1 2500457..2500630(+) (sinI) [Bacillus subtilis strain CV16]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1