Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | IF715_RS13590 | Genome accession | NZ_CP062418 |
| Coordinates | 2735255..2735725 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NAS_AN_136 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2695285..2743407 | 2735255..2735725 | within | 0 |
Gene organization within MGE regions
Location: 2695285..2743407
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IF715_RS13325 (IF715_13230) | - | 2695285..2695911 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| IF715_RS13330 (IF715_13235) | - | 2696108..2697250 (+) | 1143 | WP_240088605.1 | SdrH family protein | - |
| IF715_RS13335 (IF715_13240) | mroQ | 2697276..2698019 (-) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| IF715_RS13340 (IF715_13245) | groES | 2698194..2698478 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| IF715_RS13345 (IF715_13250) | groL | 2698554..2700170 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| IF715_RS13350 (IF715_13255) | - | 2700239..2701411 (-) | 1173 | WP_000179352.1 | tyrosine-type recombinase/integrase | - |
| IF715_RS13355 (IF715_13260) | - | 2701420..2702052 (-) | 633 | WP_000616253.1 | helix-turn-helix transcriptional regulator | - |
| IF715_RS13360 (IF715_13265) | - | 2702226..2702438 (+) | 213 | WP_000794315.1 | helix-turn-helix transcriptional regulator | - |
| IF715_RS13365 (IF715_13270) | - | 2702442..2702759 (+) | 318 | WP_000459698.1 | helix-turn-helix domain-containing protein | - |
| IF715_RS13370 (IF715_13275) | - | 2702756..2702902 (+) | 147 | WP_000784875.1 | hypothetical protein | - |
| IF715_RS13375 (IF715_13280) | - | 2702895..2703104 (+) | 210 | WP_001058486.1 | hypothetical protein | - |
| IF715_RS13380 (IF715_13285) | - | 2703107..2703406 (+) | 300 | WP_001103943.1 | DUF1474 family protein | - |
| IF715_RS13385 (IF715_13290) | - | 2703481..2705097 (+) | 1617 | WP_000344761.1 | hypothetical protein | - |
| IF715_RS13390 (IF715_13295) | - | 2705273..2706076 (+) | 804 | WP_000148374.1 | bifunctional DNA primase/polymerase | - |
| IF715_RS13395 (IF715_13300) | - | 2706063..2706335 (+) | 273 | WP_001149387.1 | hypothetical protein | - |
| IF715_RS13400 (IF715_13305) | - | 2706337..2706978 (+) | 642 | WP_001019765.1 | hypothetical protein | - |
| IF715_RS13405 (IF715_13310) | - | 2707325..2707666 (+) | 342 | WP_001161659.1 | hypothetical protein | - |
| IF715_RS13410 (IF715_13315) | - | 2707678..2708256 (+) | 579 | WP_000846292.1 | hypothetical protein | - |
| IF715_RS13415 (IF715_13320) | - | 2708274..2708492 (+) | 219 | WP_000448775.1 | capsid morphogenesis B protein | - |
| IF715_RS13420 (IF715_13325) | - | 2708543..2709070 (+) | 528 | WP_000771353.1 | spore coat protein | - |
| IF715_RS13425 (IF715_13330) | - | 2709202..2709414 (+) | 213 | WP_072326620.1 | pathogenicity island family protein | - |
| IF715_RS13430 (IF715_13335) | - | 2709411..2709980 (+) | 570 | WP_001293079.1 | terminase small subunit | - |
| IF715_RS13435 (IF715_13340) | - | 2711574..2712323 (+) | 750 | WP_000708297.1 | SAR2788 family putative toxin | - |
| IF715_RS13440 (IF715_13345) | - | 2712337..2712942 (+) | 606 | WP_000368755.1 | DUF3885 domain-containing protein | - |
| IF715_RS13445 (IF715_13350) | - | 2712929..2713621 (+) | 693 | WP_000767003.1 | S8 family serine peptidase | - |
| IF715_RS13450 (IF715_13355) | - | 2714630..2714809 (+) | 180 | WP_000201397.1 | hypothetical protein | - |
| IF715_RS13455 (IF715_13360) | - | 2714806..2715432 (+) | 627 | WP_000216894.1 | hypothetical protein | - |
| IF715_RS13460 (IF715_13365) | - | 2716004..2717311 (-) | 1308 | WP_001045078.1 | TrkH family potassium uptake protein | - |
| IF715_RS13465 (IF715_13370) | - | 2717472..2718383 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| IF715_RS13470 (IF715_13375) | - | 2718445..2719290 (+) | 846 | WP_031811354.1 | class I SAM-dependent methyltransferase | - |
| IF715_RS13475 (IF715_13380) | - | 2719662..2720885 (-) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| IF715_RS13480 (IF715_13385) | lukH | 2721320..2722372 (+) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| IF715_RS13485 (IF715_13390) | lukG | 2722394..2723410 (+) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| IF715_RS13490 (IF715_13395) | sph | 2723648..2724478 (-) | 831 | Protein_2615 | sphingomyelin phosphodiesterase | - |
| IF715_RS13495 (IF715_13400) | - | 2724529..2725566 (-) | 1038 | WP_000857176.1 | site-specific integrase | - |
| IF715_RS13500 (IF715_13405) | - | 2725674..2726288 (+) | 615 | WP_000191459.1 | hypothetical protein | - |
| IF715_RS13505 (IF715_13410) | - | 2726285..2726431 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| IF715_RS13510 (IF715_13415) | - | 2726467..2726649 (-) | 183 | WP_000705243.1 | hypothetical protein | - |
| IF715_RS13515 (IF715_13420) | - | 2726694..2727551 (-) | 858 | WP_000804508.1 | HIRAN domain-containing protein | - |
| IF715_RS13520 (IF715_13425) | - | 2727563..2728279 (-) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| IF715_RS13525 (IF715_13430) | - | 2728443..2728685 (+) | 243 | WP_000639922.1 | DUF739 family protein | - |
| IF715_RS13530 (IF715_13435) | - | 2728701..2729489 (+) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| IF715_RS13535 (IF715_13440) | - | 2729505..2729699 (+) | 195 | WP_001148859.1 | hypothetical protein | - |
| IF715_RS13540 (IF715_13445) | - | 2729694..2730050 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| IF715_RS13545 (IF715_13450) | - | 2730100..2730291 (+) | 192 | WP_000389906.1 | hypothetical protein | - |
| IF715_RS13550 (IF715_13455) | - | 2730293..2730520 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| IF715_RS13555 (IF715_13460) | - | 2730579..2730899 (+) | 321 | WP_001815221.1 | DUF771 domain-containing protein | - |
| IF715_RS13560 (IF715_13465) | - | 2730896..2731057 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| IF715_RS13565 (IF715_13470) | - | 2731150..2731410 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| IF715_RS13570 (IF715_13475) | - | 2731419..2731682 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| IF715_RS13575 (IF715_13480) | - | 2731679..2733634 (+) | 1956 | WP_001813910.1 | AAA family ATPase | - |
| IF715_RS13580 (IF715_13485) | - | 2733636..2734556 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| IF715_RS13585 (IF715_13490) | - | 2734637..2735254 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| IF715_RS13590 (IF715_13495) | ssbA | 2735255..2735725 (+) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| IF715_RS13595 (IF715_13500) | - | 2735755..2736648 (+) | 894 | WP_000148324.1 | DnaD domain-containing protein | - |
| IF715_RS13600 (IF715_13505) | - | 2736655..2736873 (+) | 219 | WP_064140628.1 | hypothetical protein | - |
| IF715_RS13605 (IF715_13510) | - | 2736882..2737286 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IF715_RS13610 (IF715_13515) | - | 2737299..2737667 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| IF715_RS13615 (IF715_13520) | - | 2737671..2737913 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| IF715_RS13620 (IF715_13525) | - | 2737927..2738313 (+) | 387 | WP_000693615.1 | hypothetical protein | - |
| IF715_RS13625 | - | 2738310..2738504 (+) | 195 | WP_000983954.1 | hypothetical protein | - |
| IF715_RS13630 (IF715_13530) | - | 2738501..2738950 (+) | 450 | WP_000982708.1 | YopX family protein | - |
| IF715_RS13635 (IF715_13535) | - | 2738947..2739231 (+) | 285 | WP_001105621.1 | hypothetical protein | - |
| IF715_RS13640 (IF715_13540) | - | 2739224..2739472 (+) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| IF715_RS13645 (IF715_13545) | - | 2739465..2740001 (+) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| IF715_RS13650 (IF715_13550) | - | 2740038..2740244 (+) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| IF715_RS13655 (IF715_13555) | - | 2740241..2740390 (+) | 150 | WP_000595267.1 | hypothetical protein | - |
| IF715_RS13660 (IF715_13560) | - | 2740549..2741199 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| IF715_RS13665 (IF715_13565) | - | 2741199..2741399 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| IF715_RS13670 (IF715_13570) | - | 2741422..2741883 (+) | 462 | WP_000282753.1 | hypothetical protein | - |
| IF715_RS13675 (IF715_13575) | - | 2741998..2742450 (+) | 453 | WP_000406186.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| IF715_RS13680 (IF715_13580) | - | 2742466..2742810 (+) | 345 | WP_174829636.1 | HNH endonuclease | - |
| IF715_RS13685 (IF715_13585) | - | 2742940..2743407 (+) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=490015 IF715_RS13590 WP_000934769.1 2735255..2735725(+) (ssbA) [Staphylococcus aureus strain NAS_AN_136]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=490015 IF715_RS13590 WP_000934769.1 2735255..2735725(+) (ssbA) [Staphylococcus aureus strain NAS_AN_136]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |