Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | IF729_RS04755 | Genome accession | NZ_CP062410 |
| Coordinates | 948537..949007 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain NAS_AN_205 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 918219..959820 | 948537..949007 | within | 0 |
Gene organization within MGE regions
Location: 918219..959820
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IF729_RS04545 (IF729_04530) | - | 918219..919673 (-) | 1455 | WP_000909218.1 | N-acetylmuramoyl-L-alanine amidase | - |
| IF729_RS04550 (IF729_04535) | - | 919684..919986 (-) | 303 | WP_000339141.1 | phage holin | - |
| IF729_RS04555 (IF729_04540) | - | 920042..920437 (-) | 396 | WP_000398862.1 | hypothetical protein | - |
| IF729_RS04560 (IF729_04545) | - | 920443..921615 (-) | 1173 | WP_000276639.1 | BppU family phage baseplate upper protein | - |
| IF729_RS04565 (IF729_04550) | - | 921628..923502 (-) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| IF729_RS04570 (IF729_04555) | - | 923639..923938 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| IF729_RS04575 (IF729_04560) | - | 923979..924152 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| IF729_RS04580 (IF729_04565) | - | 924156..924533 (-) | 378 | WP_000705907.1 | DUF2977 domain-containing protein | - |
| IF729_RS04585 (IF729_04570) | - | 924533..926356 (-) | 1824 | WP_032099400.1 | BppU family phage baseplate upper protein | - |
| IF729_RS04590 (IF729_04575) | - | 926356..928254 (-) | 1899 | WP_240053144.1 | hypothetical protein | - |
| IF729_RS04595 (IF729_04580) | - | 928267..930153 (-) | 1887 | WP_031907812.1 | SGNH/GDSL hydrolase family protein | - |
| IF729_RS04600 (IF729_04585) | - | 930164..931099 (-) | 936 | WP_031897669.1 | phage tail domain-containing protein | - |
| IF729_RS04605 (IF729_04590) | - | 931114..934083 (-) | 2970 | WP_031921309.1 | terminase | - |
| IF729_RS04610 (IF729_04595) | - | 934086..934427 (-) | 342 | WP_025173814.1 | hypothetical protein | - |
| IF729_RS04615 (IF729_04600) | - | 934448..934942 (-) | 495 | WP_000141083.1 | tail assembly chaperone | - |
| IF729_RS04620 (IF729_04605) | - | 935004..935564 (-) | 561 | WP_240053145.1 | phage tail protein | - |
| IF729_RS04625 (IF729_04610) | - | 935551..935988 (-) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| IF729_RS04630 (IF729_04615) | - | 936001..936414 (-) | 414 | WP_001151332.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| IF729_RS04635 (IF729_04620) | - | 936401..936736 (-) | 336 | WP_000482986.1 | phage head closure protein | - |
| IF729_RS04640 (IF729_04625) | - | 936729..937043 (-) | 315 | WP_000338936.1 | phage head-tail connector protein | - |
| IF729_RS04645 (IF729_04630) | - | 937043..937369 (-) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| IF729_RS04650 (IF729_04635) | - | 937386..938210 (-) | 825 | WP_001135550.1 | N4-gp56 family major capsid protein | - |
| IF729_RS04655 (IF729_04640) | - | 938231..938827 (-) | 597 | WP_000366931.1 | phage scaffolding protein | - |
| IF729_RS04660 (IF729_04645) | - | 938932..939138 (-) | 207 | WP_000346033.1 | hypothetical protein | - |
| IF729_RS04665 (IF729_04650) | - | 939140..940123 (-) | 984 | WP_049886451.1 | phage head morphogenesis protein | - |
| IF729_RS04670 (IF729_04655) | - | 940062..941480 (-) | 1419 | WP_031907816.1 | phage portal protein | - |
| IF729_RS04675 (IF729_04660) | - | 941494..942702 (-) | 1209 | WP_031907817.1 | PBSX family phage terminase large subunit | - |
| IF729_RS04680 (IF729_04665) | - | 942695..943189 (-) | 495 | WP_240053146.1 | terminase small subunit | - |
| IF729_RS04685 (IF729_04670) | - | 943541..943942 (-) | 402 | WP_000286968.1 | hypothetical protein | - |
| IF729_RS04690 (IF729_04675) | - | 943943..944116 (-) | 174 | WP_001797333.1 | transcriptional activator RinB | - |
| IF729_RS04695 (IF729_04680) | - | 944119..944319 (-) | 201 | WP_240026420.1 | hypothetical protein | - |
| IF729_RS04700 (IF729_04685) | - | 944294..944482 (-) | 189 | WP_000195776.1 | DUF1381 domain-containing protein | - |
| IF729_RS04705 (IF729_04690) | - | 944519..945049 (-) | 531 | WP_000185666.1 | dUTPase | - |
| IF729_RS04710 (IF729_04695) | - | 945042..945290 (-) | 249 | WP_001065070.1 | DUF1024 family protein | - |
| IF729_RS04715 (IF729_04700) | - | 945283..945591 (-) | 309 | WP_000144703.1 | hypothetical protein | - |
| IF729_RS04720 (IF729_04705) | - | 945588..945935 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| IF729_RS04725 (IF729_04710) | - | 945932..946336 (-) | 405 | WP_103215866.1 | hypothetical protein | - |
| IF729_RS04730 (IF729_04715) | - | 946349..946591 (-) | 243 | WP_000131395.1 | SAV1978 family virulence-associated passenger protein | - |
| IF729_RS04735 (IF729_04720) | - | 946595..946963 (-) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| IF729_RS04740 (IF729_04725) | - | 946976..947380 (-) | 405 | Protein_907 | RusA family crossover junction endodeoxyribonuclease | - |
| IF729_RS04745 (IF729_04730) | - | 947389..947607 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| IF729_RS04750 (IF729_04735) | - | 947614..948507 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| IF729_RS04755 (IF729_04740) | ssbA | 948537..949007 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| IF729_RS04760 (IF729_04745) | - | 949008..949625 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| IF729_RS04765 (IF729_04750) | - | 949706..950626 (-) | 921 | WP_000180600.1 | recombinase RecT | - |
| IF729_RS04770 (IF729_04755) | - | 950628..952571 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| IF729_RS04775 (IF729_04760) | - | 952580..952843 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| IF729_RS04780 (IF729_04765) | - | 952852..953112 (-) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| IF729_RS04785 (IF729_04770) | - | 953206..953526 (-) | 321 | WP_000219666.1 | hypothetical protein | - |
| IF729_RS04790 (IF729_04775) | - | 953527..953694 (-) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| IF729_RS13870 | - | 953687..953815 (-) | 129 | WP_001559112.1 | hypothetical protein | - |
| IF729_RS04795 (IF729_04780) | - | 953874..954104 (+) | 231 | WP_000395457.1 | hypothetical protein | - |
| IF729_RS04800 (IF729_04785) | - | 954308..954502 (-) | 195 | WP_000390105.1 | hypothetical protein | - |
| IF729_RS04805 (IF729_04790) | - | 954519..955283 (-) | 765 | WP_001002760.1 | phage antirepressor Ant | - |
| IF729_RS04810 (IF729_04795) | - | 955283..955477 (-) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| IF729_RS04815 (IF729_04800) | - | 955740..956072 (+) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| IF729_RS04820 (IF729_04805) | - | 956089..956763 (+) | 675 | WP_000775186.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IF729_RS04825 (IF729_04810) | - | 956791..957516 (+) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| IF729_RS04830 (IF729_04815) | - | 957548..958228 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| IF729_RS04835 (IF729_04820) | - | 958435..959820 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=489659 IF729_RS04755 WP_000934759.1 948537..949007(-) (ssbA) [Staphylococcus aureus strain NAS_AN_205]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=489659 IF729_RS04755 WP_000934759.1 948537..949007(-) (ssbA) [Staphylococcus aureus strain NAS_AN_205]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |