Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   IF729_RS04755 Genome accession   NZ_CP062410
Coordinates   948537..949007 (-) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain NAS_AN_205     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 918219..959820 948537..949007 within 0


Gene organization within MGE regions


Location: 918219..959820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IF729_RS04545 (IF729_04530) - 918219..919673 (-) 1455 WP_000909218.1 N-acetylmuramoyl-L-alanine amidase -
  IF729_RS04550 (IF729_04535) - 919684..919986 (-) 303 WP_000339141.1 phage holin -
  IF729_RS04555 (IF729_04540) - 920042..920437 (-) 396 WP_000398862.1 hypothetical protein -
  IF729_RS04560 (IF729_04545) - 920443..921615 (-) 1173 WP_000276639.1 BppU family phage baseplate upper protein -
  IF729_RS04565 (IF729_04550) - 921628..923502 (-) 1875 WP_000524040.1 glucosaminidase domain-containing protein -
  IF729_RS04570 (IF729_04555) - 923639..923938 (-) 300 WP_000466769.1 DUF2951 domain-containing protein -
  IF729_RS04575 (IF729_04560) - 923979..924152 (-) 174 WP_001790193.1 XkdX family protein -
  IF729_RS04580 (IF729_04565) - 924156..924533 (-) 378 WP_000705907.1 DUF2977 domain-containing protein -
  IF729_RS04585 (IF729_04570) - 924533..926356 (-) 1824 WP_032099400.1 BppU family phage baseplate upper protein -
  IF729_RS04590 (IF729_04575) - 926356..928254 (-) 1899 WP_240053144.1 hypothetical protein -
  IF729_RS04595 (IF729_04580) - 928267..930153 (-) 1887 WP_031907812.1 SGNH/GDSL hydrolase family protein -
  IF729_RS04600 (IF729_04585) - 930164..931099 (-) 936 WP_031897669.1 phage tail domain-containing protein -
  IF729_RS04605 (IF729_04590) - 931114..934083 (-) 2970 WP_031921309.1 terminase -
  IF729_RS04610 (IF729_04595) - 934086..934427 (-) 342 WP_025173814.1 hypothetical protein -
  IF729_RS04615 (IF729_04600) - 934448..934942 (-) 495 WP_000141083.1 tail assembly chaperone -
  IF729_RS04620 (IF729_04605) - 935004..935564 (-) 561 WP_240053145.1 phage tail protein -
  IF729_RS04625 (IF729_04610) - 935551..935988 (-) 438 WP_000270196.1 DUF3168 domain-containing protein -
  IF729_RS04630 (IF729_04615) - 936001..936414 (-) 414 WP_001151332.1 HK97-gp10 family putative phage morphogenesis protein -
  IF729_RS04635 (IF729_04620) - 936401..936736 (-) 336 WP_000482986.1 phage head closure protein -
  IF729_RS04640 (IF729_04625) - 936729..937043 (-) 315 WP_000338936.1 phage head-tail connector protein -
  IF729_RS04645 (IF729_04630) - 937043..937369 (-) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  IF729_RS04650 (IF729_04635) - 937386..938210 (-) 825 WP_001135550.1 N4-gp56 family major capsid protein -
  IF729_RS04655 (IF729_04640) - 938231..938827 (-) 597 WP_000366931.1 phage scaffolding protein -
  IF729_RS04660 (IF729_04645) - 938932..939138 (-) 207 WP_000346033.1 hypothetical protein -
  IF729_RS04665 (IF729_04650) - 939140..940123 (-) 984 WP_049886451.1 phage head morphogenesis protein -
  IF729_RS04670 (IF729_04655) - 940062..941480 (-) 1419 WP_031907816.1 phage portal protein -
  IF729_RS04675 (IF729_04660) - 941494..942702 (-) 1209 WP_031907817.1 PBSX family phage terminase large subunit -
  IF729_RS04680 (IF729_04665) - 942695..943189 (-) 495 WP_240053146.1 terminase small subunit -
  IF729_RS04685 (IF729_04670) - 943541..943942 (-) 402 WP_000286968.1 hypothetical protein -
  IF729_RS04690 (IF729_04675) - 943943..944116 (-) 174 WP_001797333.1 transcriptional activator RinB -
  IF729_RS04695 (IF729_04680) - 944119..944319 (-) 201 WP_240026420.1 hypothetical protein -
  IF729_RS04700 (IF729_04685) - 944294..944482 (-) 189 WP_000195776.1 DUF1381 domain-containing protein -
  IF729_RS04705 (IF729_04690) - 944519..945049 (-) 531 WP_000185666.1 dUTPase -
  IF729_RS04710 (IF729_04695) - 945042..945290 (-) 249 WP_001065070.1 DUF1024 family protein -
  IF729_RS04715 (IF729_04700) - 945283..945591 (-) 309 WP_000144703.1 hypothetical protein -
  IF729_RS04720 (IF729_04705) - 945588..945935 (-) 348 WP_000979209.1 YopX family protein -
  IF729_RS04725 (IF729_04710) - 945932..946336 (-) 405 WP_103215866.1 hypothetical protein -
  IF729_RS04730 (IF729_04715) - 946349..946591 (-) 243 WP_000131395.1 SAV1978 family virulence-associated passenger protein -
  IF729_RS04735 (IF729_04720) - 946595..946963 (-) 369 WP_000101275.1 SA1788 family PVL leukocidin-associated protein -
  IF729_RS04740 (IF729_04725) - 946976..947380 (-) 405 Protein_907 RusA family crossover junction endodeoxyribonuclease -
  IF729_RS04745 (IF729_04730) - 947389..947607 (-) 219 WP_000338528.1 hypothetical protein -
  IF729_RS04750 (IF729_04735) - 947614..948507 (-) 894 WP_000148333.1 DnaD domain-containing protein -
  IF729_RS04755 (IF729_04740) ssbA 948537..949007 (-) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  IF729_RS04760 (IF729_04745) - 949008..949625 (-) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  IF729_RS04765 (IF729_04750) - 949706..950626 (-) 921 WP_000180600.1 recombinase RecT -
  IF729_RS04770 (IF729_04755) - 950628..952571 (-) 1944 WP_000700555.1 AAA family ATPase -
  IF729_RS04775 (IF729_04760) - 952580..952843 (-) 264 WP_001205732.1 hypothetical protein -
  IF729_RS04780 (IF729_04765) - 952852..953112 (-) 261 WP_000291075.1 DUF1108 family protein -
  IF729_RS04785 (IF729_04770) - 953206..953526 (-) 321 WP_000219666.1 hypothetical protein -
  IF729_RS04790 (IF729_04775) - 953527..953694 (-) 168 WP_001285957.1 DUF1270 domain-containing protein -
  IF729_RS13870 - 953687..953815 (-) 129 WP_001559112.1 hypothetical protein -
  IF729_RS04795 (IF729_04780) - 953874..954104 (+) 231 WP_000395457.1 hypothetical protein -
  IF729_RS04800 (IF729_04785) - 954308..954502 (-) 195 WP_000390105.1 hypothetical protein -
  IF729_RS04805 (IF729_04790) - 954519..955283 (-) 765 WP_001002760.1 phage antirepressor Ant -
  IF729_RS04810 (IF729_04795) - 955283..955477 (-) 195 WP_000108122.1 helix-turn-helix transcriptional regulator -
  IF729_RS04815 (IF729_04800) - 955740..956072 (+) 333 WP_001055143.1 helix-turn-helix transcriptional regulator -
  IF729_RS04820 (IF729_04805) - 956089..956763 (+) 675 WP_000775186.1 ImmA/IrrE family metallo-endopeptidase -
  IF729_RS04825 (IF729_04810) - 956791..957516 (+) 726 WP_000661437.1 PH domain-containing protein -
  IF729_RS04830 (IF729_04815) - 957548..958228 (+) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  IF729_RS04835 (IF729_04820) - 958435..959820 (+) 1386 WP_000861313.1 recombinase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=489659 IF729_RS04755 WP_000934759.1 948537..949007(-) (ssbA) [Staphylococcus aureus strain NAS_AN_205]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=489659 IF729_RS04755 WP_000934759.1 948537..949007(-) (ssbA) [Staphylococcus aureus strain NAS_AN_205]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365