Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   IF700_RS13510 Genome accession   NZ_CP062388
Coordinates   2732444..2732914 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain NAS_AN_044     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2711104..2737927 2732444..2732914 within 0


Gene organization within MGE regions


Location: 2711104..2737927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IF700_RS13365 (IF700_13265) groES 2711104..2711388 (+) 285 WP_000917289.1 co-chaperone GroES -
  IF700_RS13370 (IF700_13270) groL 2711464..2713080 (+) 1617 WP_000240642.1 chaperonin GroEL -
  IF700_RS13375 (IF700_13275) - 2713620..2714927 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  IF700_RS13380 (IF700_13280) - 2715371..2716594 (-) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  IF700_RS13385 (IF700_13285) lukH 2717030..2718085 (+) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  IF700_RS13390 (IF700_13290) lukG 2718107..2719123 (+) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  IF700_RS13395 (IF700_13295) sph 2719361..2720191 (-) 831 Protein_2601 sphingomyelin phosphodiesterase -
  IF700_RS13400 (IF700_13300) - 2720242..2721279 (-) 1038 WP_000857180.1 site-specific integrase -
  IF700_RS13405 (IF700_13305) - 2721342..2721584 (-) 243 WP_000427213.1 hypothetical protein -
  IF700_RS13410 (IF700_13310) - 2721595..2722578 (-) 984 WP_001558608.1 glycosyltransferase family 2 protein -
  IF700_RS13415 (IF700_13315) - 2722678..2722860 (-) 183 WP_000694772.1 hypothetical protein -
  IF700_RS13420 (IF700_13320) - 2723064..2723405 (-) 342 WP_240017469.1 hypothetical protein -
  IF700_RS13425 (IF700_13325) - 2723411..2724343 (-) 933 WP_000759682.1 exonuclease domain-containing protein -
  IF700_RS13430 (IF700_13330) - 2724359..2725072 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  IF700_RS13435 (IF700_13335) - 2725035..2725209 (+) 175 Protein_2609 transcriptional regulator -
  IF700_RS13440 (IF700_13340) - 2725206..2725469 (+) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  IF700_RS13445 (IF700_13345) - 2725485..2725700 (+) 216 WP_001025404.1 MW1434 family type I TA system toxin -
  IF700_RS13450 (IF700_13350) - 2725689..2726018 (-) 330 WP_000128909.1 hypothetical protein -
  IF700_RS13455 (IF700_13355) - 2726069..2726821 (+) 753 WP_061644020.1 phage antirepressor KilAC domain-containing protein -
  IF700_RS13460 (IF700_13360) - 2726837..2727034 (+) 198 WP_001148856.1 hypothetical protein -
  IF700_RS13465 (IF700_13365) - 2727021..2727401 (-) 381 WP_000762521.1 DUF2513 domain-containing protein -
  IF700_RS13470 (IF700_13370) - 2727456..2727779 (+) 324 WP_001120201.1 DUF771 domain-containing protein -
  IF700_RS13475 (IF700_13375) - 2727776..2727937 (+) 162 WP_000048129.1 DUF1270 family protein -
  IF700_RS13480 (IF700_13380) - 2728032..2728334 (+) 303 WP_000165371.1 DUF2482 family protein -
  IF700_RS13485 (IF700_13385) - 2728339..2728599 (+) 261 WP_000291510.1 DUF1108 family protein -
  IF700_RS13490 (IF700_13390) - 2728608..2728871 (+) 264 WP_001205732.1 hypothetical protein -
  IF700_RS13495 (IF700_13395) - 2728880..2730823 (+) 1944 WP_000700554.1 AAA family ATPase -
  IF700_RS13500 (IF700_13400) - 2730825..2731745 (+) 921 WP_000180600.1 recombinase RecT -
  IF700_RS13505 (IF700_13405) - 2731826..2732443 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  IF700_RS13510 (IF700_13410) ssbA 2732444..2732914 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  IF700_RS13515 (IF700_13415) - 2732944..2733804 (+) 861 WP_196580602.1 DnaD domain-containing protein -
  IF700_RS13520 (IF700_13420) - 2733811..2734029 (+) 219 WP_000338528.1 hypothetical protein -
  IF700_RS13525 (IF700_13425) - 2734038..2734442 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  IF700_RS13530 (IF700_13430) - 2734455..2734826 (+) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  IF700_RS13535 (IF700_13435) - 2734826..2735083 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  IF700_RS13540 (IF700_13440) - 2735080..2735328 (+) 249 WP_000178987.1 SAV1978 family virulence-associated passenger protein -
  IF700_RS13545 (IF700_13445) - 2735343..2735588 (+) 246 WP_001065108.1 DUF1024 family protein -
  IF700_RS13550 (IF700_13450) - 2735585..2736121 (+) 537 WP_000185693.1 dUTPase -
  IF700_RS13555 (IF700_13455) - 2736158..2736403 (+) 246 WP_001282077.1 hypothetical protein -
  IF700_RS13560 (IF700_13460) - 2736400..2736606 (+) 207 WP_000195784.1 DUF1381 domain-containing protein -
  IF700_RS13565 (IF700_13465) - 2736603..2736752 (+) 150 WP_000595265.1 transcriptional activator RinB -
  IF700_RS13570 (IF700_13470) - 2736752..2736952 (+) 201 WP_001557462.1 DUF1514 family protein -
  IF700_RS13575 (IF700_13475) - 2736980..2737396 (+) 417 WP_000590122.1 hypothetical protein -
  IF700_RS13580 (IF700_13480) - 2737628..2737927 (+) 300 WP_000988332.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=489010 IF700_RS13510 WP_000934759.1 2732444..2732914(+) (ssbA) [Staphylococcus aureus strain NAS_AN_044]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=489010 IF700_RS13510 WP_000934759.1 2732444..2732914(+) (ssbA) [Staphylococcus aureus strain NAS_AN_044]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365