Detailed information NTG0487697

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: IF768_RS02360
• Genome accession: NZ_CP062322
• Coordinates: 440868..441179 (+)
• Length: 103 a.a.
• NCBI ID: WP_240024816.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain NAS_OP_071
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 435868..446179

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IF768_RS02330 (IF768_02330)	-	436651..436854 (+)	204	WP_000087561.1	YqgQ family protein	-
IF768_RS02335 (IF768_02335)	-	436851..437837 (+)	987	WP_000161314.1	ROK family glucokinase	-
IF768_RS02340 (IF768_02340)	-	437837..438166 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
IF768_RS02345 (IF768_02345)	-	438163..438786 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
IF768_RS02350 (IF768_02350)	comGA	438838..439812 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
IF768_RS02355 (IF768_02355)	comGB	439784..440854 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
IF768_RS02360 (IF768_02360)	comGC	440868..441179 (+)	312	WP_240024816.1	competence type IV pilus major pilin ComGC	Machinery gene
IF768_RS02365 (IF768_02365)	comGD	441157..441603 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
IF768_RS02370 (IF768_02370)	comGE	441590..441889 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
IF768_RS02375 (IF768_02375)	comGF	441807..442304 (+)	498	WP_029642894.1	competence type IV pilus minor pilin ComGF	Machinery gene
IF768_RS02380 (IF768_02380)	-	442401..442547 (+)	147	WP_001789879.1	hypothetical protein	-
IF768_RS02385 (IF768_02385)	-	442537..443061 (+)	525	WP_001015119.1	shikimate kinase	-
IF768_RS02390 (IF768_02390)	gcvT	443220..444311 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
IF768_RS02395 (IF768_02395)	gcvPA	444331..445677 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11375.39 Da
• Isoelectric Point: 8.9906

>NTDB_id=487697 IF768_RS02360 WP_240024816.1 440868..441179(+) (comGC) [Staphylococcus aureus strain NAS_OP_071]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGYNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=487697 IF768_RS02360 WP_240024816.1 440868..441179(+) (comGC) [Staphylococcus aureus strain NAS_OP_071]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTATAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus pneumoniae R6	50	83.495	0.417
comGC/cglC	Streptococcus pneumoniae Rx1	50	83.495	0.417
comGC/cglC	Streptococcus pneumoniae D39	50	83.495	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369