Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   H6P66_RS12975 Genome accession   NZ_CP062146
Coordinates   2733201..2733698 (+) Length   165 a.a.
NCBI ID   WP_192176692.1    Uniprot ID   -
Organism   Proteus mirabilis strain S012     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2697396..2743636 2733201..2733698 within 0


Gene organization within MGE regions


Location: 2697396..2743636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H6P66_RS12720 - 2697396..2698214 (+) 819 WP_049210597.1 hypothetical protein -
  H6P66_RS12725 - 2698347..2698481 (+) 135 Protein_2462 DNA polymerase III subunit theta -
  H6P66_RS12730 - 2698587..2698925 (-) 339 WP_049210595.1 hypothetical protein -
  H6P66_RS12735 - 2699008..2700387 (-) 1380 WP_192176679.1 pyocin knob domain-containing protein -
  H6P66_RS12740 - 2700404..2700670 (-) 267 WP_036905825.1 hypothetical protein -
  H6P66_RS12745 - 2700667..2701353 (-) 687 WP_112843682.1 hypothetical protein -
  H6P66_RS12750 - 2701353..2701685 (-) 333 WP_036970230.1 hypothetical protein -
  H6P66_RS12755 - 2701675..2704596 (-) 2922 WP_192176780.1 DUF1983 domain-containing protein -
  H6P66_RS12760 - 2704636..2705034 (-) 399 WP_049210594.1 DUF6950 family protein -
  H6P66_RS12765 - 2705100..2705744 (-) 645 WP_172767677.1 hypothetical protein -
  H6P66_RS12770 - 2705786..2706367 (-) 582 WP_017827264.1 hypothetical protein -
  H6P66_RS12775 - 2706364..2706963 (-) 600 WP_036901058.1 hypothetical protein -
  H6P66_RS12780 - 2706964..2710269 (-) 3306 WP_172767676.1 phage tail tape measure protein -
  H6P66_RS12785 - 2710526..2710876 (-) 351 WP_017827267.1 phage tail protein -
  H6P66_RS12790 - 2710876..2711352 (-) 477 WP_060961287.1 phage tail protein -
  H6P66_RS12795 - 2711375..2711779 (-) 405 WP_017827269.1 HK97-gp10 family putative phage morphogenesis protein -
  H6P66_RS12800 - 2711776..2712165 (-) 390 WP_017827270.1 hypothetical protein -
  H6P66_RS12805 - 2712152..2712478 (-) 327 WP_071233556.1 phage head closure protein -
  H6P66_RS12810 - 2712478..2712783 (-) 306 WP_036901048.1 head-tail connector protein -
  H6P66_RS12815 - 2712877..2714085 (-) 1209 WP_071233557.1 phage major capsid protein -
  H6P66_RS12820 - 2714099..2714743 (-) 645 WP_170832166.1 HK97 family phage prohead protease -
  H6P66_RS12825 - 2714721..2715950 (-) 1230 WP_071233558.1 phage portal protein -
  H6P66_RS12830 - 2715950..2716129 (-) 180 WP_049219082.1 hypothetical protein -
  H6P66_RS12835 - 2716139..2717878 (-) 1740 WP_192176680.1 terminase large subunit -
  H6P66_RS12840 - 2717881..2718351 (-) 471 WP_071233560.1 phage terminase small subunit P27 family -
  H6P66_RS12845 - 2718499..2718696 (-) 198 WP_049218006.1 hypothetical protein -
  H6P66_RS12850 - 2718693..2719043 (-) 351 WP_192176681.1 HNH endonuclease -
  H6P66_RS12855 - 2719109..2719615 (-) 507 WP_192176682.1 hypothetical protein -
  H6P66_RS12860 - 2719682..2720176 (-) 495 WP_192176683.1 hypothetical protein -
  H6P66_RS12865 - 2720276..2720737 (-) 462 WP_192176684.1 lysis protein -
  H6P66_RS12870 - 2720740..2720898 (-) 159 WP_167759274.1 hypothetical protein -
  H6P66_RS12875 - 2720880..2721350 (-) 471 WP_071425752.1 lysozyme -
  H6P66_RS12880 - 2721350..2721619 (-) 270 WP_004250558.1 hypothetical protein -
  H6P66_RS12885 - 2721979..2722302 (-) 324 WP_036905247.1 GrlR family regulatory protein -
  H6P66_RS12890 - 2722489..2723511 (-) 1023 WP_161779689.1 DNA-methyltransferase -
  H6P66_RS12895 - 2723585..2723779 (-) 195 WP_049210579.1 hypothetical protein -
  H6P66_RS12900 - 2723947..2724618 (-) 672 WP_070486601.1 bacteriophage antitermination protein Q -
  H6P66_RS12905 - 2724646..2725671 (-) 1026 WP_192176685.1 DUF968 domain-containing protein -
  H6P66_RS12910 - 2725668..2726471 (-) 804 WP_192176686.1 KilA-N domain-containing protein -
  H6P66_RS12915 - 2726490..2726876 (-) 387 WP_192176687.1 RusA family crossover junction endodeoxyribonuclease -
  H6P66_RS12920 - 2726949..2727344 (-) 396 WP_192176688.1 hypothetical protein -
  H6P66_RS12925 - 2727341..2727979 (-) 639 WP_192176781.1 phage N-6-adenine-methyltransferase -
  H6P66_RS12930 - 2727979..2729040 (-) 1062 WP_192176689.1 conserved phage C-terminal domain-containing protein -
  H6P66_RS12935 - 2729053..2729232 (-) 180 WP_004247132.1 DUF4222 domain-containing protein -
  H6P66_RS12940 - 2729229..2729402 (-) 174 WP_004251659.1 hypothetical protein -
  H6P66_RS12945 - 2729490..2729948 (-) 459 WP_036900998.1 YmfL family putative regulatory protein -
  H6P66_RS12950 - 2730000..2730233 (-) 234 WP_036900996.1 transcriptional regulator -
  H6P66_RS12955 - 2730338..2731027 (+) 690 WP_227718526.1 S24 family peptidase -
  H6P66_RS12960 - 2731150..2731353 (+) 204 WP_049255036.1 hypothetical protein -
  H6P66_RS12965 rdgC 2731697..2732593 (+) 897 WP_192176690.1 recombination-associated protein RdgC -
  H6P66_RS12970 - 2732675..2733208 (+) 534 WP_192176691.1 HD family hydrolase -
  H6P66_RS12975 ssb 2733201..2733698 (+) 498 WP_192176692.1 single-stranded DNA-binding protein Machinery gene
  H6P66_RS12980 - 2733712..2734413 (+) 702 WP_192176693.1 hypothetical protein -
  H6P66_RS12985 - 2734406..2734993 (+) 588 WP_192176694.1 hypothetical protein -
  H6P66_RS12990 - 2734993..2735388 (+) 396 WP_192176695.1 chromosome partitioning protein ParB -
  H6P66_RS12995 - 2735613..2736794 (+) 1182 WP_192176696.1 Arm DNA-binding domain-containing protein -
  H6P66_RS19165 - 2737473..2737559 (+) 87 WP_306440717.1 AAA family ATPase -
  H6P66_RS13005 - 2738059..2738511 (-) 453 WP_036905180.1 NUDIX hydrolase -
  H6P66_RS13010 - 2738806..2740218 (+) 1413 WP_004250459.1 hypothetical protein -
  H6P66_RS19060 - 2740523..2740726 (-) 204 WP_223232019.1 colicin E3-like toxin immunity protein -
  H6P66_RS13020 - 2741216..2743636 (+) 2421 WP_049207634.1 type I restriction-modification system subunit M -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 18115.57 Da        Isoelectric Point: 7.1639

>NTDB_id=486420 H6P66_RS12975 WP_192176692.1 2733201..2733698(+) (ssb) [Proteus mirabilis strain S012]
MANGSVNKVILIGNLGRDPEIRYLPSGGAIAYLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEIIVKIGGSMQMLGGASKSAGSQPAQQNQPPAQPQAQSSQPPMDFEDDIPFAPIGLMYPRH
LINVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=486420 H6P66_RS12975 WP_192176692.1 2733201..2733698(+) (ssb) [Proteus mirabilis strain S012]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTATTGCTTATTTAGCTGTGGCCACATCAGAAAAATGGCGTGACAAACAAACGGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTTGTTTTGTTTGGAAAACTCGCCGATATCGCCAGTGGCTATTTGTGTAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGCGTTAAACGCTATACAACAGAAATTATTGTAAAGATTGGCGG
TTCAATGCAAATGCTAGGTGGTGCTAGTAAATCAGCAGGTTCACAACCGGCGCAGCAAAACCAACCACCGGCTCAACCTC
AAGCACAGAGTAGTCAACCACCAATGGATTTTGAGGATGATATTCCCTTCGCACCGATTGGGCTTATGTATCCACGCCAT
TTAATTAATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-111)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

56.497

100

0.606
  ssb Glaesserella parasuis strain SC1401

48.619

100

0.533
  ssb Neisseria meningitidis MC58

41.243

100

0.442
  ssb Neisseria gonorrhoeae MS11

41.243

100

0.442