Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   J7W01_RS12145 Genome accession   NZ_CP072525
Coordinates   2397098..2397271 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain YB-04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2392098..2402271
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7W01_RS12130 (J7W01_12130) gcvT 2392898..2393986 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  J7W01_RS12135 (J7W01_12135) hepAA 2394427..2396100 (+) 1674 WP_041850014.1 SNF2-related protein -
  J7W01_RS12140 (J7W01_12140) yqhG 2396121..2396915 (+) 795 WP_003230200.1 YqhG family protein -
  J7W01_RS12145 (J7W01_12145) sinI 2397098..2397271 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  J7W01_RS12150 (J7W01_12150) sinR 2397305..2397640 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  J7W01_RS12155 (J7W01_12155) tasA 2397733..2398518 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  J7W01_RS12160 (J7W01_12160) sipW 2398582..2399154 (-) 573 WP_003246088.1 signal peptidase I SipW -
  J7W01_RS12165 (J7W01_12165) tapA 2399138..2399899 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  J7W01_RS12170 (J7W01_12170) yqzG 2400171..2400497 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  J7W01_RS12175 (J7W01_12175) spoIITA 2400539..2400718 (-) 180 WP_003230176.1 YqzE family protein -
  J7W01_RS12180 (J7W01_12180) comGG 2400789..2401163 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  J7W01_RS12185 (J7W01_12185) comGF 2401164..2401547 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  J7W01_RS12190 (J7W01_12190) comGE 2401573..2401920 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=483838 J7W01_RS12145 WP_003230187.1 2397098..2397271(+) (sinI) [Bacillus subtilis strain YB-04]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=483838 J7W01_RS12145 WP_003230187.1 2397098..2397271(+) (sinI) [Bacillus subtilis strain YB-04]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1